BLASTX nr result
ID: Lithospermum23_contig00042817
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00042817 (529 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_074038045.1 hypothetical protein [Exiguobacterium profundum] 86 1e-18 AFO67218.1 putative ribulose-1,5-bisphosphate carboxylase/oxygen... 86 7e-18 XP_017234552.1 PREDICTED: ribulose bisphosphate carboxylase smal... 86 1e-17 XP_017234551.1 PREDICTED: ribulose bisphosphate carboxylase smal... 86 1e-17 KCW52065.1 hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis] 85 1e-17 XP_010032637.1 PREDICTED: ribulose bisphosphate carboxylase smal... 85 1e-17 BAI53118.1 ribulose-1,5-bisphosphate carboxylase/oxygenase small... 85 1e-17 XP_019442804.1 PREDICTED: ribulose bisphosphate carboxylase smal... 85 2e-17 KCW52064.1 hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis] 85 2e-17 AEJ33935.1 chloroplast putative ribulose-1,5-bisphosphate carbox... 85 2e-17 WP_028130706.1 ribulose bisphosphate carboxylase small subunit [... 82 4e-17 KFZ35909.1 hypothetical protein HR45_19385, partial [Shewanella ... 82 5e-17 CAD11990.1 ribulose-1,5-bisphosphate carboxylase/oxygenase small... 84 5e-17 XP_019451439.1 PREDICTED: ribulose bisphosphate carboxylase smal... 83 7e-17 OCR72376.1 hypothetical protein QT29_26850, partial [Klebsiella ... 82 7e-17 AAA33866.1 ribulose 1,5-bisphosphate carboxylase small subunit [... 83 7e-17 XP_008368660.1 PREDICTED: ribulose bisphosphate carboxylase smal... 83 7e-17 OCR62350.1 hypothetical protein RE94_26735 [Klebsiella pneumoniae] 82 7e-17 OCR48611.1 hypothetical protein QH74_25785 [Klebsiella pneumonia... 82 7e-17 KDP20120.1 hypothetical protein JCGZ_05889 [Jatropha curcas] 83 8e-17 >WP_074038045.1 hypothetical protein [Exiguobacterium profundum] Length = 126 Score = 86.3 bits (212), Expect = 1e-18 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 131 LQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 +QVWPP GLKKFETLSYLPPLT EQL+KEVDYLLR+GW+PC+E Sbjct: 1 MQVWPPTGLKKFETLSYLPPLTVEQLSKEVDYLLRNGWVPCLE 43 >AFO67218.1 putative ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (plastid) [Aralia elata] Length = 183 Score = 85.9 bits (211), Expect = 7e-18 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 140 IPLLQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 + ++VWPP GLKKFETLSYLPPLT E+LAKEVDYLLRSGW+PC+E Sbjct: 56 VQCMKVWPPLGLKKFETLSYLPPLTNEELAKEVDYLLRSGWVPCLE 101 >XP_017234552.1 PREDICTED: ribulose bisphosphate carboxylase small chain 1B, chloroplastic-like [Daucus carota subsp. sativus] XP_017234553.1 PREDICTED: ribulose bisphosphate carboxylase small chain 1B, chloroplastic-like [Daucus carota subsp. sativus] XP_017234554.1 PREDICTED: ribulose bisphosphate carboxylase small chain 1B, chloroplastic-like [Daucus carota subsp. sativus] XP_017235154.1 PREDICTED: ribulose bisphosphate carboxylase small chain 1B, chloroplastic-like [Daucus carota subsp. sativus] Length = 179 Score = 85.5 bits (210), Expect = 1e-17 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 140 IPLLQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 + ++VWPP +KKFETLSYLPPLTTEQLAKEVDYLLRSGW+PC+E Sbjct: 55 VQCMKVWPPINMKKFETLSYLPPLTTEQLAKEVDYLLRSGWVPCLE 100 >XP_017234551.1 PREDICTED: ribulose bisphosphate carboxylase small chain 1B, chloroplastic-like [Daucus carota subsp. sativus] Length = 179 Score = 85.5 bits (210), Expect = 1e-17 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 140 IPLLQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 + ++VWPP +KKFETLSYLPPLTTEQLAKEVDYLLRSGW+PC+E Sbjct: 55 VQCMKVWPPINMKKFETLSYLPPLTTEQLAKEVDYLLRSGWVPCLE 100 >KCW52065.1 hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis] Length = 180 Score = 85.1 bits (209), Expect = 1e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -3 Query: 140 IPLLQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 + +QVWPP GLKKFETLSYLPPLT QLAKE+DYLLRSGW+PC+E Sbjct: 56 VQCMQVWPPVGLKKFETLSYLPPLTPTQLAKEIDYLLRSGWVPCLE 101 >XP_010032637.1 PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic [Eucalyptus grandis] Length = 181 Score = 85.1 bits (209), Expect = 1e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -3 Query: 140 IPLLQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 + +QVWPP GLKKFETLSYLPPLT QLAKE+DYLLRSGW+PC+E Sbjct: 56 VQCMQVWPPVGLKKFETLSYLPPLTPTQLAKEIDYLLRSGWVPCLE 101 >BAI53118.1 ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit [Eucalyptus globulus] Length = 181 Score = 85.1 bits (209), Expect = 1e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -3 Query: 140 IPLLQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 + +QVWPP GLKKFETLSYLPPLT QLAKE+DYLLRSGW+PC+E Sbjct: 56 VQCMQVWPPVGLKKFETLSYLPPLTPTQLAKEIDYLLRSGWVPCLE 101 >XP_019442804.1 PREDICTED: ribulose bisphosphate carboxylase small chain F1, chloroplastic-like [Lupinus angustifolius] OIW12223.1 hypothetical protein TanjilG_06012 [Lupinus angustifolius] Length = 176 Score = 84.7 bits (208), Expect = 2e-17 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = -3 Query: 140 IPLLQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 + ++VWPP GLKKFETLSYLPPLTTE LAKEVDYL+R+GW+PC+E Sbjct: 51 VQCMKVWPPIGLKKFETLSYLPPLTTESLAKEVDYLIRNGWVPCLE 96 >KCW52064.1 hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis] Length = 192 Score = 85.1 bits (209), Expect = 2e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -3 Query: 140 IPLLQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 + +QVWPP GLKKFETLSYLPPLT QLAKE+DYLLRSGW+PC+E Sbjct: 56 VQCMQVWPPVGLKKFETLSYLPPLTPTQLAKEIDYLLRSGWVPCLE 101 >AEJ33935.1 chloroplast putative ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit [Wolffia australiana] Length = 177 Score = 84.7 bits (208), Expect = 2e-17 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 131 LQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 +QVWPP GLKKFETLSYLPPL+TE LAKEV+YL+R+GWIPCIE Sbjct: 58 MQVWPPEGLKKFETLSYLPPLSTEALAKEVEYLIRNGWIPCIE 100 >WP_028130706.1 ribulose bisphosphate carboxylase small subunit [Serratia marcescens] Length = 123 Score = 82.4 bits (202), Expect = 4e-17 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -3 Query: 131 LQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 +QVWPP GLKKFETLSYLP LTTEQLAKE++YLLRS W+PC+E Sbjct: 1 MQVWPPTGLKKFETLSYLPDLTTEQLAKEIEYLLRSKWVPCLE 43 >KFZ35909.1 hypothetical protein HR45_19385, partial [Shewanella mangrovi] Length = 107 Score = 81.6 bits (200), Expect = 5e-17 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 131 LQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 +QVWPP G KKFETLSYLPPLT EQLAKEV+YL+R GWIPC+E Sbjct: 1 MQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWIPCLE 43 >CAD11990.1 ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit [Coffea arabica] CAD11991.1 ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit [Coffea arabica] Length = 181 Score = 83.6 bits (205), Expect = 5e-17 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -3 Query: 140 IPLLQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 + +QVWPPRGLKK+ETLSYLP LT EQL KE+DYL+RSGW+PC+E Sbjct: 56 VQCMQVWPPRGLKKYETLSYLPDLTDEQLLKEIDYLIRSGWVPCLE 101 >XP_019451439.1 PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like [Lupinus angustifolius] OIW06419.1 hypothetical protein TanjilG_05190 [Lupinus angustifolius] Length = 176 Score = 83.2 bits (204), Expect = 7e-17 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = -3 Query: 140 IPLLQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 + ++VWPP GLKKFETLSYLPPL+TE LAKEVDYLL++GW+PC+E Sbjct: 51 VQCMKVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLKNGWVPCLE 96 >OCR72376.1 hypothetical protein QT29_26850, partial [Klebsiella pneumoniae] Length = 121 Score = 81.6 bits (200), Expect = 7e-17 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 131 LQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 +QVWPP G KKFETLSYLPPLT EQLAKEV+YL+R GWIPC+E Sbjct: 1 MQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWIPCLE 43 >AAA33866.1 ribulose 1,5-bisphosphate carboxylase small subunit [Malus domestica x Pyrus communis] Length = 179 Score = 83.2 bits (204), Expect = 7e-17 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -3 Query: 140 IPLLQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 + +QVWPP GLKKFETLSYLPPL+TE LAKEVDYLLR W+PC+E Sbjct: 54 VQCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLE 99 >XP_008368660.1 PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic [Malus domestica] Length = 179 Score = 83.2 bits (204), Expect = 7e-17 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -3 Query: 140 IPLLQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 + +QVWPP GLKKFETLSYLPPL+TE LAKEVDYLLR W+PC+E Sbjct: 54 VQCMQVWPPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLE 99 >OCR62350.1 hypothetical protein RE94_26735 [Klebsiella pneumoniae] Length = 123 Score = 81.6 bits (200), Expect = 7e-17 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 131 LQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 +QVWPP G KKFETLSYLPPLT EQLAKEV+YL+R GWIPC+E Sbjct: 1 MQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWIPCLE 43 >OCR48611.1 hypothetical protein QH74_25785 [Klebsiella pneumoniae] OCR61045.1 hypothetical protein RE93_25490 [Klebsiella pneumoniae] Length = 123 Score = 81.6 bits (200), Expect = 7e-17 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 131 LQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 +QVWPP G KKFETLSYLPPLT EQLAKEV+YL+R GWIPC+E Sbjct: 1 MQVWPPVGKKKFETLSYLPPLTEEQLAKEVEYLIRKGWIPCLE 43 >KDP20120.1 hypothetical protein JCGZ_05889 [Jatropha curcas] Length = 181 Score = 83.2 bits (204), Expect = 8e-17 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = -3 Query: 140 IPLLQVWPPRGLKKFETLSYLPPLTTEQLAKEVDYLLRSGWIPCIE 3 + ++VWP +GLKKFETLSYLPPLT EQLAKEV+YLLRSGW+PC+E Sbjct: 56 VQCMKVWPTQGLKKFETLSYLPPLTREQLAKEVEYLLRSGWVPCLE 101