BLASTX nr result
ID: Lithospermum23_contig00042580
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00042580 (587 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009786070.1 PREDICTED: uncharacterized protein LOC104234228 [... 54 1e-06 >XP_009786070.1 PREDICTED: uncharacterized protein LOC104234228 [Nicotiana sylvestris] Length = 58 Score = 53.5 bits (127), Expect = 1e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -2 Query: 457 KIIQMKPWVEVAPSLLVTPHKPSHFPKLEPIKED 356 K++ MKPW+EVAP L+++P K SH PKLE IKED Sbjct: 10 KVVNMKPWIEVAPPLVISPTKLSHSPKLETIKED 43