BLASTX nr result
ID: Lithospermum23_contig00042522
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00042522 (461 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDO98298.1 unnamed protein product [Coffea canephora] 55 5e-06 >CDO98298.1 unnamed protein product [Coffea canephora] Length = 418 Score = 55.1 bits (131), Expect = 5e-06 Identities = 24/37 (64%), Positives = 28/37 (75%), Gaps = 2/37 (5%) Frame = +2 Query: 356 RNWRWGIF--VLLALLLKTEAWKFPKLQHHQTERISG 460 RNWRWG+ V LA +++TEAWKF K QH TERISG Sbjct: 2 RNWRWGLIGIVFLAFVIRTEAWKFSKAQHEHTERISG 38