BLASTX nr result
ID: Lithospermum23_contig00042374
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00042374 (500 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010548092.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-09 XP_009757299.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-08 XP_016497628.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-08 XP_016479444.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-08 XP_009757298.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-08 XP_006422620.1 hypothetical protein CICLE_v10027997mg [Citrus cl... 63 2e-08 XP_009618141.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-08 CBI37886.3 unnamed protein product, partial [Vitis vinifera] 62 3e-08 XP_002277741.3 PREDICTED: pentatricopeptide repeat-containing pr... 62 3e-08 XP_019225946.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 5e-08 OIT32346.1 pentatricopeptide repeat-containing protein [Nicotian... 62 5e-08 XP_017970204.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 1e-07 EOX97699.1 Pentatricopeptide repeat-containing protein [Theobrom... 60 1e-07 XP_006486756.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 1e-07 XP_019165672.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 3e-07 OMO92797.1 hypothetical protein COLO4_17314 [Corchorus olitorius] 59 5e-07 XP_015169999.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 2e-06 XP_016539941.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 3e-06 XP_010090328.1 hypothetical protein L484_024993 [Morus notabilis... 55 6e-06 XP_015062577.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 8e-06 >XP_010548092.1 PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Tarenaya hassleriana] Length = 644 Score = 65.5 bits (158), Expect = 2e-09 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = +3 Query: 6 RLCKEGVIESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFS 149 RL K+G++ES VLL+N+YASVGRFQDAEALRL+MD +GL K G S Sbjct: 595 RLSKQGIMESVDTVLLSNVYASVGRFQDAEALRLSMDQRGLRKKAGIS 642 >XP_009757299.1 PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like isoform X2 [Nicotiana sylvestris] Length = 421 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVT 158 +SGQ+VLL+NLYASVGRFQDAEALRL+M+ + L KD GFS +T Sbjct: 376 DSGQLVLLSNLYASVGRFQDAEALRLSMETEKLIKDPGFSILT 418 >XP_016497628.1 PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Nicotiana tabacum] Length = 602 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVT 158 +SGQ+VLL+NLYASVGRFQDAEALRL+M+ + L KD GFS +T Sbjct: 557 DSGQLVLLSNLYASVGRFQDAEALRLSMETEKLIKDPGFSILT 599 >XP_016479444.1 PREDICTED: pentatricopeptide repeat-containing protein At3g03580-like [Nicotiana tabacum] Length = 602 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVT 158 +SGQ+VLL+NLYASVGRFQDAEALRL+M+ + L KD GFS +T Sbjct: 557 DSGQLVLLSNLYASVGRFQDAEALRLSMETEKLIKDPGFSILT 599 >XP_009757298.1 PREDICTED: pentatricopeptide repeat-containing protein At3g03580-like isoform X1 [Nicotiana sylvestris] Length = 604 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVT 158 +SGQ+VLL+NLYASVGRFQDAEALRL+M+ + L KD GFS +T Sbjct: 559 DSGQLVLLSNLYASVGRFQDAEALRLSMETEKLIKDPGFSILT 601 >XP_006422620.1 hypothetical protein CICLE_v10027997mg [Citrus clementina] ESR35860.1 hypothetical protein CICLE_v10027997mg [Citrus clementina] Length = 645 Score = 62.8 bits (151), Expect = 2e-08 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVTESSYDSG 179 ESGQVVLL+N+YASVGRFQDAEALR KG+ K G SF+ +S+D G Sbjct: 596 ESGQVVLLSNVYASVGRFQDAEALRSGSQKKGIIKIPGISFLNSTSHDFG 645 >XP_009618141.1 PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Nicotiana tomentosiformis] Length = 602 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVT 158 +SGQ+VLL+NLYASVGRFQDAEALRL+M+ + L KD GFS +T Sbjct: 557 DSGQLVLLSNLYASVGRFQDAEALRLSMETEKLIKDPGFSVLT 599 >CBI37886.3 unnamed protein product, partial [Vitis vinifera] Length = 648 Score = 62.0 bits (149), Expect = 3e-08 Identities = 33/58 (56%), Positives = 40/58 (68%) Frame = +3 Query: 6 RLCKEGVIESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVTESSYDSG 179 R+C+ E GQVVLL+N+YASVGRFQDAEALR +M K L K+ G S + YD G Sbjct: 591 RVCELDPEEPGQVVLLSNVYASVGRFQDAEALRASMKKKELIKNPGISLLNRIPYDVG 648 >XP_002277741.3 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic [Vitis vinifera] Length = 688 Score = 62.0 bits (149), Expect = 3e-08 Identities = 33/58 (56%), Positives = 40/58 (68%) Frame = +3 Query: 6 RLCKEGVIESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVTESSYDSG 179 R+C+ E GQVVLL+N+YASVGRFQDAEALR +M K L K+ G S + YD G Sbjct: 631 RVCELDPEEPGQVVLLSNVYASVGRFQDAEALRASMKKKELIKNPGISLLNRIPYDVG 688 >XP_019225946.1 PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Nicotiana attenuata] Length = 602 Score = 61.6 bits (148), Expect = 5e-08 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVT 158 +SGQ+VLL+NLYASVGRFQDAEALRL+M + L KD GFS +T Sbjct: 557 DSGQLVLLSNLYASVGRFQDAEALRLSMGTEKLIKDPGFSILT 599 >OIT32346.1 pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 649 Score = 61.6 bits (148), Expect = 5e-08 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVT 158 +SGQ+VLL+NLYASVGRFQDAEALRL+M + L KD GFS +T Sbjct: 604 DSGQLVLLSNLYASVGRFQDAEALRLSMGTEKLIKDPGFSILT 646 >XP_017970204.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic [Theobroma cacao] Length = 649 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVTESSYDSG 179 ES +VVLL+N+YASVGRFQDAEALRL+M K L K+ G S + YD G Sbjct: 600 ESDEVVLLSNVYASVGRFQDAEALRLDMQKKALIKNPGVSLLCRIPYDGG 649 >EOX97699.1 Pentatricopeptide repeat-containing protein [Theobroma cacao] Length = 649 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVTESSYDSG 179 ES +VVLL+N+YASVGRFQDAEALRL+M K L K+ G S + YD G Sbjct: 600 ESDEVVLLSNVYASVGRFQDAEALRLDMQKKALIKNPGVSLLCRIPYDGG 649 >XP_006486756.1 PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Citrus sinensis] Length = 654 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/50 (64%), Positives = 36/50 (72%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVTESSYDSG 179 ESGQVVLL+N YASVGRFQDAEALR KG+ K G SF+ +S D G Sbjct: 605 ESGQVVLLSNAYASVGRFQDAEALRSGSQKKGIIKIPGISFLNSTSRDFG 654 >XP_019165672.1 PREDICTED: pentatricopeptide repeat-containing protein At3g03580-like [Ipomoea nil] XP_019165674.1 PREDICTED: pentatricopeptide repeat-containing protein At3g03580-like [Ipomoea nil] Length = 667 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/58 (55%), Positives = 40/58 (68%) Frame = +3 Query: 6 RLCKEGVIESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVTESSYDSG 179 RL ++ + Q VLL+NLYA VGRFQDAEALRLNM K KD G SF++ + Y+ G Sbjct: 610 RLHEQAEADPEQAVLLSNLYALVGRFQDAEALRLNMVGKKSMKDPGLSFLSGNLYNGG 667 >OMO92797.1 hypothetical protein COLO4_17314 [Corchorus olitorius] Length = 659 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVTESSYDSG 179 ES +VLL+N+YASVGRF+DAEALRL+M K + K+ G S + + YDSG Sbjct: 610 ESDHIVLLSNVYASVGRFKDAEALRLSMQKKAVIKNPGVSLLCKIPYDSG 659 >XP_015169999.1 PREDICTED: pentatricopeptide repeat-containing protein At3g03580-like [Solanum tuberosum] Length = 642 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVT 158 + GQ+VLL+NLYASVGRF+DAEALRL+MD L K GFS +T Sbjct: 597 DPGQLVLLSNLYASVGRFKDAEALRLSMDTDKLIKAPGFSILT 639 >XP_016539941.1 PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like [Capsicum annuum] Length = 648 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVT 158 + GQ+VLL+NLYASVGRF+DAEALRL+MD + L K GFS +T Sbjct: 603 DPGQLVLLSNLYASVGRFKDAEALRLSMDTQKLIKVPGFSNLT 645 >XP_010090328.1 hypothetical protein L484_024993 [Morus notabilis] EXB39298.1 hypothetical protein L484_024993 [Morus notabilis] Length = 649 Score = 55.5 bits (132), Expect = 6e-06 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVTESSYDSG 179 +SGQVVLL+N+YASVGRF DAE LR ++ GL K+ G SF+ D G Sbjct: 600 KSGQVVLLSNIYASVGRFHDAEVLRQSLTKSGLTKNPGISFLNGIPCDFG 649 >XP_015062577.1 PREDICTED: pentatricopeptide repeat-containing protein At3g03580-like [Solanum pennellii] Length = 645 Score = 55.1 bits (131), Expect = 8e-06 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +3 Query: 30 ESGQVVLLANLYASVGRFQDAEALRLNMDFKGLNKDRGFSFVT 158 + GQ+VLL+NLYASVGRF+DAEALR +MD + L K GFS +T Sbjct: 600 DPGQLVLLSNLYASVGRFKDAEALRSSMDTQKLIKVPGFSILT 642