BLASTX nr result
ID: Lithospermum23_contig00042348
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00042348 (231 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV51818.1 alpha-glucosidase [Dorcoceras hygrometricum] 52 8e-06 >KZV51818.1 alpha-glucosidase [Dorcoceras hygrometricum] Length = 934 Score = 51.6 bits (122), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 229 KKKNMMVEVSGLELPLGKIFAMSWKMGIKA 140 K N+MVE+ GLELPLGK F+MSWKMGIKA Sbjct: 905 KMNNVMVEIGGLELPLGKKFSMSWKMGIKA 934