BLASTX nr result
ID: Lithospermum23_contig00042311
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00042311 (365 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK34045.1 unknown [Medicago truncatula] 60 2e-08 XP_014627716.1 PREDICTED: uncharacterized protein LOC100782805 i... 60 3e-08 KHN20512.1 Transcription factor Pur-alpha 1 [Glycine soja] 60 3e-08 XP_003529454.1 PREDICTED: transcription factor Pur-alpha 1 [Glyc... 60 3e-08 XP_014509964.1 PREDICTED: transcription factor Pur-alpha 1 [Vign... 60 3e-08 XP_017406193.1 PREDICTED: transcription factor Pur-alpha 1 [Vign... 60 3e-08 XP_007157829.1 hypothetical protein PHAVU_002G101600g [Phaseolus... 60 3e-08 NP_001241408.1 uncharacterized protein LOC100782805 [Glycine max... 60 3e-08 XP_019424208.1 PREDICTED: transcription factor Pur-alpha 1-like ... 60 3e-08 KYP76512.1 Transcription factor Pur-alpha 1, partial [Cajanus ca... 60 3e-08 XP_003607817.1 transcription factor Pur-alpha-like protein [Medi... 60 3e-08 XP_015960062.1 PREDICTED: transcription factor Pur-alpha 1 [Arac... 60 3e-08 XP_011025087.1 PREDICTED: transcription factor Pur-alpha 1-like ... 60 3e-08 XP_004505354.1 PREDICTED: transcription factor Pur-alpha 1 [Cice... 60 3e-08 KDO54540.1 hypothetical protein CISIN_1g022247mg [Citrus sinensis] 60 3e-08 XP_006445544.1 hypothetical protein CICLE_v10016090mg [Citrus cl... 60 3e-08 XP_002304844.2 hypothetical protein POPTR_0003s20690g [Populus t... 60 3e-08 KZV50552.1 transcription factor Pur-alpha 1 [Dorcoceras hygromet... 60 4e-08 XP_011048132.1 PREDICTED: transcription factor Pur-alpha 1-like ... 60 4e-08 XP_006368525.1 hypothetical protein POPTR_0001s03780g [Populus t... 60 4e-08 >AFK34045.1 unknown [Medicago truncatula] Length = 217 Score = 60.1 bits (144), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 115 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 146 >XP_014627716.1 PREDICTED: uncharacterized protein LOC100782805 isoform X1 [Glycine max] KRG89469.1 hypothetical protein GLYMA_20G025100 [Glycine max] Length = 274 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 106 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 137 >KHN20512.1 Transcription factor Pur-alpha 1 [Glycine soja] Length = 283 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 103 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 134 >XP_003529454.1 PREDICTED: transcription factor Pur-alpha 1 [Glycine max] KHN42955.1 Transcription factor Pur-alpha 1 [Glycine soja] KRH50512.1 hypothetical protein GLYMA_07G225200 [Glycine max] Length = 283 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 103 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 134 >XP_014509964.1 PREDICTED: transcription factor Pur-alpha 1 [Vigna radiata var. radiata] Length = 284 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 104 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 135 >XP_017406193.1 PREDICTED: transcription factor Pur-alpha 1 [Vigna angularis] XP_017406196.1 PREDICTED: transcription factor Pur-alpha 1 [Vigna angularis] KOM31750.1 hypothetical protein LR48_Vigan01g130500 [Vigna angularis] BAT74802.1 hypothetical protein VIGAN_01256200 [Vigna angularis var. angularis] Length = 284 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 104 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 135 >XP_007157829.1 hypothetical protein PHAVU_002G101600g [Phaseolus vulgaris] ESW29823.1 hypothetical protein PHAVU_002G101600g [Phaseolus vulgaris] Length = 284 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 104 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 135 >NP_001241408.1 uncharacterized protein LOC100782805 [Glycine max] ACU20767.1 unknown [Glycine max] KRG89470.1 hypothetical protein GLYMA_20G025100 [Glycine max] Length = 286 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 106 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 137 >XP_019424208.1 PREDICTED: transcription factor Pur-alpha 1-like [Lupinus angustifolius] OIV93343.1 hypothetical protein TanjilG_23279 [Lupinus angustifolius] Length = 288 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 111 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 142 >KYP76512.1 Transcription factor Pur-alpha 1, partial [Cajanus cajan] Length = 289 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 109 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 140 >XP_003607817.1 transcription factor Pur-alpha-like protein [Medicago truncatula] AES90014.1 transcription factor Pur-alpha-like protein [Medicago truncatula] Length = 293 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 115 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 146 >XP_015960062.1 PREDICTED: transcription factor Pur-alpha 1 [Arachis duranensis] XP_016198075.1 PREDICTED: transcription factor Pur-alpha 1 [Arachis ipaensis] Length = 294 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 116 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 147 >XP_011025087.1 PREDICTED: transcription factor Pur-alpha 1-like [Populus euphratica] Length = 295 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 115 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 146 >XP_004505354.1 PREDICTED: transcription factor Pur-alpha 1 [Cicer arietinum] Length = 295 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 115 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 146 >KDO54540.1 hypothetical protein CISIN_1g022247mg [Citrus sinensis] Length = 300 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 120 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 151 >XP_006445544.1 hypothetical protein CICLE_v10016090mg [Citrus clementina] XP_006488970.1 PREDICTED: transcription factor Pur-alpha 1 [Citrus sinensis] ESR58784.1 hypothetical protein CICLE_v10016090mg [Citrus clementina] KDO54541.1 hypothetical protein CISIN_1g022247mg [Citrus sinensis] Length = 300 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 120 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 151 >XP_002304844.2 hypothetical protein POPTR_0003s20690g [Populus trichocarpa] EEE79823.2 hypothetical protein POPTR_0003s20690g [Populus trichocarpa] Length = 302 Score = 60.1 bits (144), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 122 FLKVSEASVSRNRSTIIVPAGSSRDEGWAAFR 153 >KZV50552.1 transcription factor Pur-alpha 1 [Dorcoceras hygrometricum] Length = 269 Score = 59.7 bits (143), Expect = 4e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L++SEAS SRNRSTIIVPAGSSRDEGWAAFR Sbjct: 94 FLKISEASVSRNRSTIIVPAGSSRDEGWAAFR 125 >XP_011048132.1 PREDICTED: transcription factor Pur-alpha 1-like [Populus euphratica] Length = 296 Score = 59.7 bits (143), Expect = 4e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTII+PAGSSRDEGWAAFR Sbjct: 115 FLKVSEASVSRNRSTIIIPAGSSRDEGWAAFR 146 >XP_006368525.1 hypothetical protein POPTR_0001s03780g [Populus trichocarpa] ERP65094.1 hypothetical protein POPTR_0001s03780g [Populus trichocarpa] Length = 297 Score = 59.7 bits (143), Expect = 4e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 98 YLQVSEASGSRNRSTIIVPAGSSRDEGWAAFR 3 +L+VSEAS SRNRSTII+PAGSSRDEGWAAFR Sbjct: 116 FLKVSEASVSRNRSTIIIPAGSSRDEGWAAFR 147