BLASTX nr result
ID: Lithospermum23_contig00042014
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00042014 (324 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016455835.1 PREDICTED: pentatricopeptide repeat-containing pr... 130 5e-33 XP_009802076.1 PREDICTED: pentatricopeptide repeat-containing pr... 130 5e-33 XP_019243845.1 PREDICTED: pentatricopeptide repeat-containing pr... 128 2e-32 XP_016447319.1 PREDICTED: pentatricopeptide repeat-containing pr... 125 4e-31 XP_009630608.1 PREDICTED: pentatricopeptide repeat-containing pr... 125 4e-31 XP_006364204.1 PREDICTED: pentatricopeptide repeat-containing pr... 121 6e-30 XP_010318779.1 PREDICTED: pentatricopeptide repeat-containing pr... 118 8e-29 XP_015067835.1 PREDICTED: pentatricopeptide repeat-containing pr... 117 3e-28 XP_019153824.1 PREDICTED: pentatricopeptide repeat-containing pr... 116 4e-28 KZM88424.1 hypothetical protein DCAR_025499 [Daucus carota subsp... 114 2e-27 XP_017219435.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 2e-27 XP_016562838.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 3e-27 XP_015933247.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 8e-27 XP_016174055.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 110 5e-26 XP_018809420.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 3e-25 XP_016172240.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 5e-25 CDO98138.1 unnamed protein product [Coffea canephora] 107 5e-25 XP_015933761.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 5e-25 XP_003542113.1 PREDICTED: pentatricopeptide repeat-containing pr... 106 2e-24 XP_009339263.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 3e-24 >XP_016455835.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Nicotiana tabacum] XP_016455836.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Nicotiana tabacum] Length = 817 Score = 130 bits (327), Expect = 5e-33 Identities = 62/104 (59%), Positives = 81/104 (77%), Gaps = 2/104 (1%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSP--FPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAE 134 MSK++L RIKPLH PK SSP FP T INEL+N++ +I++TQ+ W+ +VE LSE E Sbjct: 1 MSKTLLSRIKPLHNPKPKTSSPTNFPLTRRINELVNEVCQILQTQDQWEHTVETRLSEEE 60 Query: 133 IIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 ++PS+IAH VFDK++D +GLKF+DWVS RP+G LD FAYSSL Sbjct: 61 VVPSDIAHHVFDKLKDAHVGLKFFDWVSQRPYGCPLDRFAYSSL 104 >XP_009802076.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Nicotiana sylvestris] XP_009802077.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Nicotiana sylvestris] Length = 817 Score = 130 bits (327), Expect = 5e-33 Identities = 62/104 (59%), Positives = 81/104 (77%), Gaps = 2/104 (1%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSP--FPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAE 134 MSK++L RIKPLH PK SSP FP T INEL+N++ +I++TQ+ W+ +VE LSE E Sbjct: 1 MSKTLLSRIKPLHNPKPKTSSPTNFPLTRRINELVNEVCQILQTQDQWEHTVETRLSEEE 60 Query: 133 IIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 ++PS+IAH VFDK++D +GLKF+DWVS RP+G LD FAYSSL Sbjct: 61 VVPSDIAHHVFDKLKDAHVGLKFFDWVSQRPYGCPLDRFAYSSL 104 >XP_019243845.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Nicotiana attenuata] XP_019243846.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Nicotiana attenuata] OIT05068.1 pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 817 Score = 128 bits (322), Expect = 2e-32 Identities = 61/104 (58%), Positives = 80/104 (76%), Gaps = 2/104 (1%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSP--FPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAE 134 MSK++L RIKPLH PK SP FP T INEL+N++ +I++TQ+ W+ +VE LSE E Sbjct: 1 MSKTLLSRIKPLHNPKPKTPSPTNFPLTRRINELVNEVCQILQTQDQWEHTVETRLSEEE 60 Query: 133 IIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 ++PS+IAH VFDK++D +GLKF+DWVS RP+G LD FAYSSL Sbjct: 61 VVPSDIAHHVFDKLKDAHVGLKFFDWVSQRPYGCPLDRFAYSSL 104 >XP_016447319.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Nicotiana tabacum] Length = 785 Score = 125 bits (313), Expect = 4e-31 Identities = 60/104 (57%), Positives = 79/104 (75%), Gaps = 2/104 (1%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSP--FPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAE 134 MSK++L IKPLHKPK SP FP T EL+N++ +I++TQ+ W+ +VEI LSE E Sbjct: 1 MSKTLLSLIKPLHKPKPRTPSPTNFPLTRRSKELVNEVCQILQTQDQWEHTVEIRLSEEE 60 Query: 133 IIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 ++PS+IAH VFDK++D +GLKF+DWVS RP+G LD FAYSSL Sbjct: 61 VVPSDIAHHVFDKLKDAHVGLKFFDWVSQRPYGCPLDRFAYSSL 104 >XP_009630608.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Nicotiana tomentosiformis] Length = 817 Score = 125 bits (313), Expect = 4e-31 Identities = 60/104 (57%), Positives = 79/104 (75%), Gaps = 2/104 (1%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSP--FPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAE 134 MSK++L IKPLHKPK SP FP T EL+N++ +I++TQ+ W+ +VEI LSE E Sbjct: 1 MSKTLLSLIKPLHKPKPRTPSPTNFPLTRRSKELVNEVCQILQTQDQWEHTVEIRLSEEE 60 Query: 133 IIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 ++PS+IAH VFDK++D +GLKF+DWVS RP+G LD FAYSSL Sbjct: 61 VVPSDIAHHVFDKLKDAHVGLKFFDWVSQRPYGCPLDRFAYSSL 104 >XP_006364204.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum tuberosum] XP_015159311.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum tuberosum] XP_015159312.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum tuberosum] XP_015159313.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum tuberosum] Length = 816 Score = 121 bits (304), Expect = 6e-30 Identities = 60/104 (57%), Positives = 79/104 (75%), Gaps = 2/104 (1%) Frame = -3 Query: 307 MSKSILCRIKPLH--KPKRTYSSPFPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAE 134 MSK++L RIKPLH KPK SS P T I EL+N++ +I++TQ W+++VEI LS+ E Sbjct: 1 MSKTLLSRIKPLHNPKPKPPSSSNLPLTRRIKELVNEVCQILQTQQQWENAVEIRLSQEE 60 Query: 133 IIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 I+PS+IAH VFDK++D +GLKF+DWVS RP+G LD FA SSL Sbjct: 61 IVPSDIAHLVFDKLKDAHVGLKFFDWVSQRPYGCPLDRFACSSL 104 >XP_010318779.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum lycopersicum] XP_010318780.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum lycopersicum] XP_010318781.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum lycopersicum] XP_010318782.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum lycopersicum] XP_019068641.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum lycopersicum] XP_019068642.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum lycopersicum] Length = 814 Score = 118 bits (296), Expect = 8e-29 Identities = 59/105 (56%), Positives = 77/105 (73%), Gaps = 3/105 (2%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKR---TYSSPFPDTTNINELINDLYKIIRTQNDWQDSVEILLSEA 137 MSK++L RIKPLH PK + SS FP T I E++N++ +I+ TQ W+D+VEI LS+ Sbjct: 1 MSKTLLSRIKPLHNPKPKPPSSSSNFPLTRRIKEVVNEVCQILHTQQQWEDAVEIRLSQE 60 Query: 136 EIIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 EI+P +IAH VFDK++D +GLKF+DWVS RP G LD FA SSL Sbjct: 61 EIVPPDIAHLVFDKLKDAHVGLKFFDWVSQRPDGCPLDRFACSSL 105 >XP_015067835.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Solanum pennellii] Length = 828 Score = 117 bits (292), Expect = 3e-28 Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 3/105 (2%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKR---TYSSPFPDTTNINELINDLYKIIRTQNDWQDSVEILLSEA 137 MSK++L RIKPLH PK + SS FP T I E++N++ +I+ TQ W+++VEI LS+ Sbjct: 1 MSKTLLSRIKPLHNPKPKPPSSSSNFPLTRRIKEVVNEVCRILHTQQQWENAVEIRLSQE 60 Query: 136 EIIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 EI+PS+IAH VFDK++D +GLKF+DWVS RP G L+ FA SSL Sbjct: 61 EIVPSDIAHLVFDKLKDAHVGLKFFDWVSQRPDGCPLNRFACSSL 105 >XP_019153824.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Ipomoea nil] Length = 830 Score = 116 bits (291), Expect = 4e-28 Identities = 60/104 (57%), Positives = 77/104 (74%), Gaps = 2/104 (1%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSPFP--DTTNINELINDLYKIIRTQNDWQDSVEILLSEAE 134 MSKS+L RIK L K SSP+ I EL+ ++ +I+RTQN W+ ++E LSEA+ Sbjct: 1 MSKSLLSRIKHLCNQKPNRSSPWTLRVAPRIKELVIEVCEILRTQNHWEQNLETRLSEAQ 60 Query: 133 IIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 ++PSEIA+ VFDKI+D ELGLKF+DWVS RP+G LDGFAYSSL Sbjct: 61 VVPSEIAYLVFDKIQDAELGLKFFDWVSRRPYGCPLDGFAYSSL 104 >KZM88424.1 hypothetical protein DCAR_025499 [Daucus carota subsp. sativus] Length = 676 Score = 114 bits (285), Expect = 2e-27 Identities = 57/104 (54%), Positives = 78/104 (75%), Gaps = 2/104 (1%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSP-FPDTTNINELINDLYKIIRTQN-DWQDSVEILLSEAE 134 MSKS+L RIKP H K S P +P +TNIN+++N + I+RT++ W+ ++E LSE E Sbjct: 1 MSKSVLSRIKPRHITKLKPSLPLYPSSTNINKIVNQVCDILRTRHIQWEQTLETKLSECE 60 Query: 133 IIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 ++PS+IAH VFDKI+D ELGLKF+ WV+ RP+G +LD AYSSL Sbjct: 61 VVPSDIAHLVFDKIQDSELGLKFFYWVTDRPYGCSLDASAYSSL 104 >XP_017219435.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Daucus carota subsp. sativus] XP_017219436.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Daucus carota subsp. sativus] Length = 828 Score = 114 bits (285), Expect = 2e-27 Identities = 57/104 (54%), Positives = 78/104 (75%), Gaps = 2/104 (1%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSP-FPDTTNINELINDLYKIIRTQN-DWQDSVEILLSEAE 134 MSKS+L RIKP H K S P +P +TNIN+++N + I+RT++ W+ ++E LSE E Sbjct: 1 MSKSVLSRIKPRHITKLKPSLPLYPSSTNINKIVNQVCDILRTRHIQWEQTLETKLSECE 60 Query: 133 IIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 ++PS+IAH VFDKI+D ELGLKF+ WV+ RP+G +LD AYSSL Sbjct: 61 VVPSDIAHLVFDKIQDSELGLKFFYWVTDRPYGCSLDASAYSSL 104 >XP_016562838.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Capsicum annuum] XP_016562839.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Capsicum annuum] XP_016562840.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Capsicum annuum] XP_016562841.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Capsicum annuum] XP_016562842.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Capsicum annuum] XP_016562843.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620 [Capsicum annuum] Length = 816 Score = 114 bits (284), Expect = 3e-27 Identities = 58/104 (55%), Positives = 76/104 (73%), Gaps = 2/104 (1%) Frame = -3 Query: 307 MSKSILCRIKPLH--KPKRTYSSPFPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAE 134 MSK++L RIKP + KPK SS FP T +I +LIN+L +I+ TQ W+++VE LSE E Sbjct: 1 MSKTLLSRIKPFNNPKPKTPSSSNFPLTRHIKQLINELCQILHTQQQWENTVESRLSEEE 60 Query: 133 IIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 I+PS+IA VFDK++D +GLKF+ WVS RP+G LD FA SSL Sbjct: 61 IVPSDIARLVFDKLKDAHVGLKFFGWVSNRPYGCPLDRFACSSL 104 >XP_015933247.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like, partial [Arachis duranensis] Length = 820 Score = 112 bits (281), Expect = 8e-27 Identities = 53/102 (51%), Positives = 74/102 (72%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSPFPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAEII 128 MSK+IL RIKP ++PK T +P + I+ L+ D +I+ T WQDS+E +E+E++ Sbjct: 1 MSKAILARIKPRNRPKATTFTPTRFSPCIHNLVIDAVRILATHAQWQDSLESRFAESEVL 60 Query: 127 PSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 S++AH V D+I DPELGLKF+DW ++RPF +LDGFAYSSL Sbjct: 61 VSDVAHFVLDRIHDPELGLKFFDWANSRPFSCSLDGFAYSSL 102 >XP_016174055.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g52620-like [Arachis ipaensis] Length = 789 Score = 110 bits (275), Expect = 5e-26 Identities = 52/102 (50%), Positives = 73/102 (71%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSPFPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAEII 128 MSK+IL RI P ++PK T +P + I+ L+ D +I+ T WQDS+E +E+E++ Sbjct: 1 MSKAILARITPRNRPKATTFTPTRFSPCIHNLVIDAVRILATHAQWQDSLESRFAESEVL 60 Query: 127 PSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 S++AH V D+I DPELGLKF+DW ++RPF +LDGFAYSSL Sbjct: 61 VSDVAHFVLDRIHDPELGLKFFDWANSRPFSCSLDGFAYSSL 102 >XP_018809420.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Juglans regia] XP_018809421.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Juglans regia] XP_018809422.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Juglans regia] XP_018809423.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Juglans regia] XP_018809425.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Juglans regia] Length = 1042 Score = 108 bits (269), Expect = 3e-25 Identities = 52/104 (50%), Positives = 75/104 (72%), Gaps = 2/104 (1%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTY--SSPFPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAE 134 MSK++L RIKPL++PK Y SSPFP + +L+ D +I++ W+ S+EI +E++ Sbjct: 224 MSKTLLSRIKPLNRPKPIYFSSSPFPCRPYV-KLVQDCVQILKNHEQWEKSLEIHFAESQ 282 Query: 133 IIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 ++ S+IAH V D+I D ELGLKF+DW S RP+ +LDG+AYSSL Sbjct: 283 VLVSDIAHHVLDRIHDVELGLKFFDWASKRPYSCSLDGYAYSSL 326 >XP_016172240.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Arachis ipaensis] Length = 820 Score = 107 bits (268), Expect = 5e-25 Identities = 51/102 (50%), Positives = 72/102 (70%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSPFPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAEII 128 MSK+IL RIKP + K T +P + I+ L+ D +I+ T WQDS+E +E+E++ Sbjct: 1 MSKAILARIKPRNLSKATTFTPTRFSPCIHNLVIDAVRILATHAQWQDSLESRFAESEVL 60 Query: 127 PSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 S++AH + D+I DPELGLKF+DW ++RPF +LDGFAYSSL Sbjct: 61 VSDVAHFILDRIHDPELGLKFFDWANSRPFSCSLDGFAYSSL 102 >CDO98138.1 unnamed protein product [Coffea canephora] Length = 820 Score = 107 bits (268), Expect = 5e-25 Identities = 56/103 (54%), Positives = 73/103 (70%), Gaps = 1/103 (0%) Frame = -3 Query: 307 MSKSILCRIKPLH-KPKRTYSSPFPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAEI 131 MSK++L IK L PK T+ P P T I L+ ++ +I+RTQ W++ +E LS EI Sbjct: 1 MSKNLLSGIKRLKPNPKSTHEIPVP--TQIKRLVVEVCEILRTQTQWEEMLEARLSVEEI 58 Query: 130 IPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 +PSEIAH VFDKI + +LGLKF+ WVS RP+G +LDGFAYSSL Sbjct: 59 VPSEIAHLVFDKIHNADLGLKFFGWVSDRPYGCSLDGFAYSSL 101 >XP_015933761.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Arachis duranensis] Length = 826 Score = 107 bits (268), Expect = 5e-25 Identities = 51/102 (50%), Positives = 73/102 (71%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSPFPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAEII 128 MSK+IL RIKP ++PK T +P + I+ LI D +I+ T WQDS+ +E+E++ Sbjct: 1 MSKAILARIKPRNRPKATTYTPTRFSPCIHNLIIDAVRILATHAQWQDSLASRFAESEVL 60 Query: 127 PSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 S++A+ + D+I DPELGLKF+DW ++RPF +LDGFAYSSL Sbjct: 61 VSDVANFILDRIHDPELGLKFFDWANSRPFSCSLDGFAYSSL 102 >XP_003542113.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Glycine max] KRH23565.1 hypothetical protein GLYMA_13G364500 [Glycine max] Length = 825 Score = 106 bits (264), Expect = 2e-24 Identities = 53/104 (50%), Positives = 75/104 (72%), Gaps = 2/104 (1%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSPFPDTTNINELINDLYKIIRTQ--NDWQDSVEILLSEAE 134 MSK+IL RIKP H+PK + SS P IN L++D+ +I+RT + WQD +E +E++ Sbjct: 1 MSKAILSRIKPRHRPKGSSSSLPP---RINHLVSDVIQILRTSKTHQWQDPLESRFAESK 57 Query: 133 IIPSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 ++ S++AH V D++ D ELGLKF+DW STRPF +LDG A+SSL Sbjct: 58 VVVSDVAHFVIDRVHDAELGLKFFDWASTRPFSCSLDGVAHSSL 101 >XP_009339263.1 PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Pyrus x bretschneideri] Length = 819 Score = 105 bits (262), Expect = 3e-24 Identities = 50/102 (49%), Positives = 68/102 (66%) Frame = -3 Query: 307 MSKSILCRIKPLHKPKRTYSSPFPDTTNINELINDLYKIIRTQNDWQDSVEILLSEAEII 128 MSK++L RIKP H K T SS P ++ L+ND +I+RTQ+ W+ S+E SE E + Sbjct: 1 MSKTLLSRIKPFHNRKPTSSSSSPPPPHVKRLVNDTIQILRTQHHWEQSLETQFSETETL 60 Query: 127 PSEIAHQVFDKIRDPELGLKFYDWVSTRPFGPTLDGFAYSSL 2 S++AH V D++ D ELGLKF+DW RP+ + DG AYSSL Sbjct: 61 VSDVAHFVLDRVHDVELGLKFFDWAFKRPYCCSPDGSAYSSL 102