BLASTX nr result
ID: Lithospermum23_contig00042000
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00042000 (360 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007221541.1 hypothetical protein PRUPE_ppa024354mg [Prunus pe... 54 6e-06 >XP_007221541.1 hypothetical protein PRUPE_ppa024354mg [Prunus persica] Length = 263 Score = 53.5 bits (127), Expect = 6e-06 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = +3 Query: 3 QELIARDLHDVEWKFRHIFRGTVSDLPNLLEKDHLPPFHASLY 131 QELIARDLHDVEWKFRHIFRG V + +L + L F L+ Sbjct: 168 QELIARDLHDVEWKFRHIFRGMVYMINSLFINEMLAKFSIPLW 210