BLASTX nr result
ID: Lithospermum23_contig00041868
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00041868 (608 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_001862574.1 conserved hypothetical protein [Culex quinquefasc... 57 3e-06 >XP_001862574.1 conserved hypothetical protein [Culex quinquefasciatus] EDS37212.1 conserved hypothetical protein [Culex quinquefasciatus] Length = 1348 Score = 57.4 bits (137), Expect = 3e-06 Identities = 42/160 (26%), Positives = 74/160 (46%), Gaps = 14/160 (8%) Frame = +3 Query: 9 SSPKNSPQSGTKETSRLPTTITQLSSATDGKPVAASSSAQEHT--PSNEIPGQPKEQIPT 182 S P+ P S + ++ T +SS+++ K A +S A+ T S+E P E++ Sbjct: 508 SQPEEQPTSSSPAEAKKTTDDAAISSSSEPKETAEASPAEAETVTSSDEKPASEPEKVVD 567 Query: 183 SLGDSESPIPTPGVIASNANYQ------------SAEIPESRLKPEAAKKVTEKVQETKD 326 S ++ SP PTP ++ + +AE+ E+ + A + TEK +E K+ Sbjct: 568 STPEAASPAPTPAEPQADEAMEVDAVEPVVEASTAAEVSEAPCAKKEAYQCTEKEEEKKE 627 Query: 327 TDMVKEKNVINELQREGSSFSNEIKEQRNVAVPPKQSNGD 446 KE+ + E ++ + +E E + AV P QS D Sbjct: 628 DTTPKEEVAVAEPEKVTPTEEDEQMEVDSAAVAPSQSKSD 667