BLASTX nr result
ID: Lithospermum23_contig00041379
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00041379 (370 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_064091.1 orf103c gene product (mitochondrion) [Beta vulgaris ... 77 6e-16 CBX33251.1 hypothetical protein (mitochondrion) [Beta vulgaris s... 55 3e-07 >NP_064091.1 orf103c gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] YP_004222332.1 hypothetical protein BevumaM_p098 (mitochondrion) [Beta vulgaris subsp. maritima] YP_004842138.1 hypothetical protein BemaM_p094 (mitochondrion) [Beta macrocarpa] BAA99484.1 orf103c (mitochondrion) [Beta vulgaris subsp. vulgaris] CBJ14063.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ17554.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBX24943.1 hypothetical protein (mitochondrion) [Beta macrocarpa] CBL51976.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 103 Score = 77.0 bits (188), Expect = 6e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -2 Query: 117 SVKNIYRAIHSESLFLYI*NFDKSLANSSKELSYLYLCM 1 SVKNIYRAIHSESLFLYI NFDKSLANSSKELSYLYLCM Sbjct: 59 SVKNIYRAIHSESLFLYIRNFDKSLANSSKELSYLYLCM 97 >CBX33251.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 110 Score = 54.7 bits (130), Expect = 3e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 117 SVKNIYRAIHSESLFLYI*NFDKSLANSSKE 25 SVKNIYRAIHSESLFLYI NFDKSLA+SS + Sbjct: 59 SVKNIYRAIHSESLFLYIRNFDKSLASSSPQ 89