BLASTX nr result
ID: Lithospermum23_contig00041333
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00041333 (297 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012837725.1 PREDICTED: replication protein A 70 kDa DNA-bindi... 55 1e-06 >XP_012837725.1 PREDICTED: replication protein A 70 kDa DNA-binding subunit B-like [Erythranthe guttata] EYU37212.1 hypothetical protein MIMGU_mgv11b022413mg [Erythranthe guttata] Length = 515 Score = 55.1 bits (131), Expect = 1e-06 Identities = 24/70 (34%), Positives = 38/70 (54%) Frame = +1 Query: 1 LEHLAMTKLLNMTQVVQLHEVIDENSTLTDGNYYCF*ARIKAINNQSKPYYDSCERCTKA 180 ++ LAM + + V LHE+I L++ YY F A + + N+S +YDSC +C A Sbjct: 254 IQALAMKERIKKANKVTLHEIIHNRFLLSEDEYYFFKATVNKVENKSYIWYDSCTKCNSA 313 Query: 181 IMRTSDNVEC 210 I + D + C Sbjct: 314 ISKNGDTMAC 323