BLASTX nr result
ID: Lithospermum23_contig00041303
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00041303 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019192329.1 PREDICTED: probable serine incorporator isoform X... 55 1e-06 >XP_019192329.1 PREDICTED: probable serine incorporator isoform X2 [Ipomoea nil] Length = 407 Score = 54.7 bits (130), Expect = 1e-06 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 2/62 (3%) Frame = -3 Query: 270 LGWSAIKSEPP*EKCLGQTK--TTNGDWLTIMXXXXXXXXXXXXXFSTGNDSKIFQVQTW 97 L WSAI+SEPP EKC+ + K T+ GD LTI+ FSTG DSK FQVQ W Sbjct: 256 LCWSAIRSEPPEEKCIRKAKAATSKGDVLTIISFVVAVLAIVVATFSTGIDSKCFQVQFW 315 Query: 96 QE 91 ++ Sbjct: 316 KD 317