BLASTX nr result
ID: Lithospermum23_contig00040994
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00040994 (314 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT50758.1 Retrovirus-related Pol polyprotein LINE-1, partial [A... 54 3e-06 GAV83447.1 hypothetical protein CFOL_v3_26894 [Cephalotus follic... 52 8e-06 >JAT50758.1 Retrovirus-related Pol polyprotein LINE-1, partial [Anthurium amnicola] Length = 1070 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/69 (34%), Positives = 36/69 (52%) Frame = +2 Query: 101 MCNYKWLDCFRGCKIHIPTPCYFDHYSLDIDVEDEIVQGPKPFKFQPFWIYHPDYNEVIR 280 + N +W+ F +H DH + I D+I + PKPFKF + HPD+ +V+ Sbjct: 202 LVNEEWISEFPSSLLHYGPSLISDHAMMQISTVDDIPKEPKPFKFHAMCVSHPDFIKVVS 261 Query: 281 EA*NKHDKG 307 EA + H KG Sbjct: 262 EAWHSHSKG 270 >GAV83447.1 hypothetical protein CFOL_v3_26894 [Cephalotus follicularis] Length = 248 Score = 52.4 bits (124), Expect = 8e-06 Identities = 21/61 (34%), Positives = 34/61 (55%) Frame = +2 Query: 101 MCNYKWLDCFRGCKIHIPTPCYFDHYSLDIDVEDEIVQGPKPFKFQPFWIYHPDYNEVIR 280 M N++W +CF +H+ P DH L I + ++ +PFKF W HPD++ ++R Sbjct: 43 MGNWQWFNCFGDSFVHVHNPGISDHSPLSIQLMQQVRTTGRPFKFLNLWADHPDFSILVR 102 Query: 281 E 283 E Sbjct: 103 E 103