BLASTX nr result
ID: Lithospermum23_contig00040984
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00040984 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018810432.1 PREDICTED: AP2-like ethylene-responsive transcrip... 52 8e-06 >XP_018810432.1 PREDICTED: AP2-like ethylene-responsive transcription factor ANT [Juglans regia] Length = 681 Score = 52.0 bits (123), Expect = 8e-06 Identities = 23/33 (69%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = -2 Query: 97 WLGFSLSQNMKMEVTSKPQEHQHNHHH-GQSST 2 WLGFSLS MKMEVT+ PQ HQH +HH GQ+S+ Sbjct: 14 WLGFSLSPQMKMEVTTDPQHHQHQYHHQGQASS 46