BLASTX nr result
ID: Lithospermum23_contig00040927
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00040927 (386 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002321338.2 hypothetical protein POPTR_0014s18000g, partial [... 55 3e-06 >XP_002321338.2 hypothetical protein POPTR_0014s18000g, partial [Populus trichocarpa] EEE99653.2 hypothetical protein POPTR_0014s18000g, partial [Populus trichocarpa] Length = 486 Score = 55.1 bits (131), Expect = 3e-06 Identities = 33/104 (31%), Positives = 59/104 (56%), Gaps = 5/104 (4%) Frame = -1 Query: 386 PG*ANVVVDGLSRKGK--LGALMILGKKSMIDMKCMGVRGGIGVNGNLLVQLRV-TLLSE 216 P AN+V D LSRK K +G + + K +I++ + R G+G+NG+LL Q+ +L + Sbjct: 353 PSMANIVADALSRKNKAVIGGMTVNNVKELIELGELRTRMGVGLNGSLLAQMVARPMLWD 412 Query: 215 SSNHNRK*EI--EKDN*ECKNGNRSNFAIRNDGVITMGRKIFVP 90 +K ++ EK E K + F +R DG++ M +++++P Sbjct: 413 KILEAQKNDVKAEKIKGEIKLKQETLFQLREDGILAMQKRVYIP 456