BLASTX nr result
ID: Lithospermum23_contig00040856
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00040856 (671 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002531499.1 PREDICTED: ganglioside-induced differentiation-as... 57 3e-06 XP_006407595.1 hypothetical protein EUTSA_v10021434mg [Eutrema s... 57 4e-06 GAU17891.1 hypothetical protein TSUD_330170 [Trifolium subterran... 56 8e-06 XP_004493410.1 PREDICTED: ganglioside-induced differentiation-as... 56 8e-06 KJB32991.1 hypothetical protein B456_006G1334001 [Gossypium raim... 55 8e-06 >XP_002531499.1 PREDICTED: ganglioside-induced differentiation-associated protein 2 [Ricinus communis] EEF30886.1 conserved hypothetical protein [Ricinus communis] Length = 261 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 574 YTAQVISAERLKNYIFHKIINEAPEGPFCIVY 669 + AQVISAERLK YIFHK+ +E PEGPFCIVY Sbjct: 94 FPAQVISAERLKKYIFHKMCSELPEGPFCIVY 125 >XP_006407595.1 hypothetical protein EUTSA_v10021434mg [Eutrema salsugineum] ESQ49048.1 hypothetical protein EUTSA_v10021434mg [Eutrema salsugineum] Length = 237 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 574 YTAQVISAERLKNYIFHKIINEAPEGPFCIVY 669 + A+V+SAERLK YIFHKI NE PEGPFC+VY Sbjct: 75 FPARVVSAERLKKYIFHKISNEYPEGPFCLVY 106 >GAU17891.1 hypothetical protein TSUD_330170 [Trifolium subterraneum] Length = 252 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +1 Query: 574 YTAQVISAERLKNYIFHKIINEAPEGPFCIVY 669 Y A V+SAERLK Y+FHKI +E P+GPFCIVY Sbjct: 80 YPATVVSAERLKRYVFHKIFSELPDGPFCIVY 111 >XP_004493410.1 PREDICTED: ganglioside-induced differentiation-associated protein 2 [Cicer arietinum] Length = 252 Score = 55.8 bits (133), Expect = 8e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +1 Query: 574 YTAQVISAERLKNYIFHKIINEAPEGPFCIVY 669 Y A V+SAERLK Y+FHKI +E P+GPFCIVY Sbjct: 80 YPATVVSAERLKRYVFHKIFSELPDGPFCIVY 111 >KJB32991.1 hypothetical protein B456_006G1334001 [Gossypium raimondii] Length = 169 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 574 YTAQVISAERLKNYIFHKIINEAPEGPFCIVY 669 Y A V+S ERLK YI+HKI +E PEGPFCIVY Sbjct: 2 YAAPVVSGERLKRYIYHKICSELPEGPFCIVY 33