BLASTX nr result
ID: Lithospermum23_contig00040715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00040715 (233 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016561835.1 PREDICTED: serine carboxypeptidase-like 34 [Capsi... 52 8e-06 >XP_016561835.1 PREDICTED: serine carboxypeptidase-like 34 [Capsicum annuum] Length = 470 Score = 51.6 bits (122), Expect = 8e-06 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = +3 Query: 66 LYTHLLLIVVTCGLASVVLAARHPPVNPHGGVLEEQEADRVIGLPGQPPVSFDHYA 233 ++ + +L+VV+ G V+L R V VL EQEADRVIGLPGQPPVSF YA Sbjct: 1 MFRYFILLVVSFG---VLLGTRGDIVTKE--VLAEQEADRVIGLPGQPPVSFKQYA 51