BLASTX nr result
ID: Lithospermum23_contig00040440
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00040440 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI11791.1 hypothetical protein Ccrd_009794 [Cynara cardunculus ... 57 2e-07 XP_019068703.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 2e-06 XP_015068346.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 4e-06 XP_016563183.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 4e-06 XP_018468425.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 5e-06 XP_006341567.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 5e-06 XP_010693152.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 5e-06 XP_019168730.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 7e-06 XP_007160512.1 hypothetical protein PHAVU_002G328100g [Phaseolus... 52 9e-06 >KVI11791.1 hypothetical protein Ccrd_009794 [Cynara cardunculus var. scolymus] Length = 782 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = +2 Query: 149 AKIVPISQIVQWNKSIANFMKNGNYQSALCLFNSMNQRTVVSWNTMMS 292 A IV S IVQWN +I N+M++G SAL +F M+QRT VSWN M+S Sbjct: 57 APIVSDSTIVQWNTTITNYMRSGQCDSALRMFEKMSQRTSVSWNAMIS 104 >XP_019068703.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Solanum lycopersicum] Length = 765 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = +2 Query: 167 SQIVQWNKSIANFMKNGNYQSALCLFNSMNQRTVVSWNTMMS 292 S IVQWN+SI +M+ G SAL LFNSM ++ VSWN M+S Sbjct: 46 SDIVQWNRSITQYMRQGECDSALTLFNSMPAKSCVSWNAMLS 87 >XP_015068346.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Solanum pennellii] XP_015068347.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Solanum pennellii] Length = 765 Score = 53.5 bits (127), Expect = 4e-06 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = +2 Query: 167 SQIVQWNKSIANFMKNGNYQSALCLFNSMNQRTVVSWNTMMS 292 S IVQWN+SI +M+ G SAL LFNSM ++ VSWN M+S Sbjct: 46 SDIVQWNRSITQYMRQGECDSALNLFNSMPAKSCVSWNAMLS 87 >XP_016563183.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Capsicum annuum] XP_016563184.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Capsicum annuum] XP_016563185.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Capsicum annuum] Length = 768 Score = 53.5 bits (127), Expect = 4e-06 Identities = 25/48 (52%), Positives = 32/48 (66%) Frame = +2 Query: 149 AKIVPISQIVQWNKSIANFMKNGNYQSALCLFNSMNQRTVVSWNTMMS 292 A V S IVQWN+S+ +M+ G SAL LFNSM ++ VSWN M+S Sbjct: 43 ASKVSSSDIVQWNRSVTQYMREGELDSALRLFNSMPVKSCVSWNAMIS 90 >XP_018468425.1 PREDICTED: pentatricopeptide repeat-containing protein At1g53600, mitochondrial [Raphanus sativus] Length = 725 Score = 53.1 bits (126), Expect = 5e-06 Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 1/70 (1%) Frame = +2 Query: 86 KPNTKSFTSFK-SVETTSTTHSAKIVPISQIVQWNKSIANFMKNGNYQSALCLFNSMNQR 262 KPN + T + SVE T+T+ S I QWN I+ ++GN Q A +F SM QR Sbjct: 31 KPNPPTTTRTQNSVERTTTSTS--------IFQWNSQISKLARDGNLQEAEAIFKSMPQR 82 Query: 263 TVVSWNTMMS 292 ++VSWN M+S Sbjct: 83 SIVSWNAMIS 92 >XP_006341567.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Solanum tuberosum] XP_015161708.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Solanum tuberosum] Length = 765 Score = 53.1 bits (126), Expect = 5e-06 Identities = 28/49 (57%), Positives = 33/49 (67%) Frame = +2 Query: 146 SAKIVPISQIVQWNKSIANFMKNGNYQSALCLFNSMNQRTVVSWNTMMS 292 SAK V S IVQWN+SI M+ G SAL LFNSM ++ VSWN M+S Sbjct: 40 SAK-VSSSDIVQWNRSITQHMRQGECDSALSLFNSMPAKSSVSWNAMLS 87 >XP_010693152.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Beta vulgaris subsp. vulgaris] KMS99291.1 hypothetical protein BVRB_2g046200 [Beta vulgaris subsp. vulgaris] Length = 774 Score = 53.1 bits (126), Expect = 5e-06 Identities = 21/44 (47%), Positives = 33/44 (75%) Frame = +2 Query: 161 PISQIVQWNKSIANFMKNGNYQSALCLFNSMNQRTVVSWNTMMS 292 P +++WN I+N+M+ G Y+ A+ LF+SM +RTVVSWN M++ Sbjct: 53 PDKDVIKWNTQISNYMRRGQYRLAVELFHSMPRRTVVSWNAMIT 96 >XP_019168730.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Ipomoea nil] Length = 769 Score = 52.8 bits (125), Expect = 7e-06 Identities = 27/59 (45%), Positives = 34/59 (57%) Frame = +2 Query: 116 KSVETTSTTHSAKIVPISQIVQWNKSIANFMKNGNYQSALCLFNSMNQRTVVSWNTMMS 292 K E H A V S IV+WN I M+NG +SAL LF SM ++ VSWN+M+S Sbjct: 33 KVSEDAKPQHMASSVASSNIVKWNVLITKHMRNGECESALRLFKSMPRKNCVSWNSMIS 91 >XP_007160512.1 hypothetical protein PHAVU_002G328100g [Phaseolus vulgaris] ESW32506.1 hypothetical protein PHAVU_002G328100g [Phaseolus vulgaris] Length = 783 Score = 52.4 bits (124), Expect = 9e-06 Identities = 27/55 (49%), Positives = 40/55 (72%) Frame = +2 Query: 128 TTSTTHSAKIVPISQIVQWNKSIANFMKNGNYQSALCLFNSMNQRTVVSWNTMMS 292 +T+TT+S K+ IV WNK+I++ M+NG SAL +FNSM +R+ VS+N M+S Sbjct: 52 STTTTNSVKVKD-PDIVTWNKAISSHMRNGYCDSALRVFNSMPRRSSVSYNAMIS 105