BLASTX nr result
ID: Lithospermum23_contig00040314
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00040314 (247 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACO55633.1 chloroplast photosystem II type I chlorophyll a/b-bin... 86 2e-20 NP_001266111.1 chlorophyll a-b binding protein AB80, chloroplast... 90 5e-20 XP_013457337.1 light-harvesting complex I chlorophyll A/B-bindin... 90 5e-20 GAU40650.1 hypothetical protein TSUD_83280 [Trifolium subterraneum] 89 1e-19 AAC25775.1 chlorophyll a/b binding protein [Medicago sativa] 89 1e-19 XP_019463510.1 PREDICTED: chlorophyll a-b binding protein 3, chl... 87 7e-19 XP_016190537.1 PREDICTED: chlorophyll a-b binding protein of LHC... 87 7e-19 BAH70299.1 chlorophyll a/b binding protein [Vicia cinerea] 86 1e-18 XP_018819730.1 PREDICTED: chlorophyll a-b binding protein of LHC... 86 2e-18 XP_015967983.1 PREDICTED: chlorophyll a-b binding protein of LHC... 86 2e-18 XP_015957489.1 PREDICTED: chlorophyll a-b binding protein of LHC... 86 2e-18 XP_013450965.1 light-harvesting complex I chlorophyll A/B-bindin... 86 2e-18 AFK39586.1 unknown [Medicago truncatula] 86 2e-18 AAR10886.1 chlorophyll a/b binding protein [Trifolium pratense] 86 2e-18 P07371.1 RecName: Full=Chlorophyll a-b binding protein AB80, chl... 85 4e-18 XP_011045092.1 PREDICTED: chlorophyll a-b binding protein of LHC... 84 5e-18 ABN49454.2 chloroplast chlorophyll a/b binding protein [Pisum sa... 84 6e-18 AAW31511.1 light-harvesting chlorophyll-a/b binding protein Lhcb... 84 6e-18 XP_013450966.1 light-harvesting complex I chlorophyll A/B-bindin... 84 8e-18 GAU43953.1 hypothetical protein TSUD_284600 [Trifolium subterran... 84 8e-18 >ACO55633.1 chloroplast photosystem II type I chlorophyll a/b-binding protein, partial [Arachis diogoi] Length = 69 Score = 85.5 bits (210), Expect = 2e-20 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKVSSGSPWYGPDRVKYLGPFSGEP 245 G+A+KLSPS ELG GR +MR+A T K+VSSGSPWYGPDRVKYLGPFSGEP Sbjct: 15 GQAIKLSPSNPELGVGRVTMRKAAT-KQVSSGSPWYGPDRVKYLGPFSGEP 64 >NP_001266111.1 chlorophyll a-b binding protein AB80, chloroplastic-like [Cicer arietinum] CAA10284.1 chlorophyll a/b binding protein [Cicer arietinum] Length = 266 Score = 89.7 bits (221), Expect = 5e-20 Identities = 43/52 (82%), Positives = 46/52 (88%), Gaps = 1/52 (1%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKV-SSGSPWYGPDRVKYLGPFSGEP 245 GK VKLSPS ELGA RF+MR++ TTKKV SSGSPWYGPDRVKYLGPFSGEP Sbjct: 15 GKPVKLSPSSQELGASRFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEP 66 >XP_013457337.1 light-harvesting complex I chlorophyll A/B-binding protein [Medicago truncatula] AFK40061.1 unknown [Medicago truncatula] KEH31368.1 light-harvesting complex I chlorophyll A/B-binding protein [Medicago truncatula] Length = 266 Score = 89.7 bits (221), Expect = 5e-20 Identities = 43/52 (82%), Positives = 46/52 (88%), Gaps = 1/52 (1%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKV-SSGSPWYGPDRVKYLGPFSGEP 245 GK VKL+PS ELGA RF+MR+A TTKKV SSGSPWYGPDRVKYLGPFSGEP Sbjct: 15 GKPVKLTPSSQELGAARFTMRKAATTKKVASSGSPWYGPDRVKYLGPFSGEP 66 >GAU40650.1 hypothetical protein TSUD_83280 [Trifolium subterraneum] Length = 266 Score = 88.6 bits (218), Expect = 1e-19 Identities = 42/52 (80%), Positives = 46/52 (88%), Gaps = 1/52 (1%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKV-SSGSPWYGPDRVKYLGPFSGEP 245 GK VKL+PS ELGA +F+MR+A TTKKV SSGSPWYGPDRVKYLGPFSGEP Sbjct: 15 GKPVKLTPSSQELGAAKFTMRKAATTKKVASSGSPWYGPDRVKYLGPFSGEP 66 >AAC25775.1 chlorophyll a/b binding protein [Medicago sativa] Length = 266 Score = 88.6 bits (218), Expect = 1e-19 Identities = 42/52 (80%), Positives = 46/52 (88%), Gaps = 1/52 (1%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKV-SSGSPWYGPDRVKYLGPFSGEP 245 GK VKL+PS ELGA RF+MR++ TTKKV SSGSPWYGPDRVKYLGPFSGEP Sbjct: 15 GKPVKLTPSSQELGAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEP 66 >XP_019463510.1 PREDICTED: chlorophyll a-b binding protein 3, chloroplastic [Lupinus angustifolius] XP_019463511.1 PREDICTED: chlorophyll a-b binding protein 3, chloroplastic [Lupinus angustifolius] OIW00776.1 hypothetical protein TanjilG_22275 [Lupinus angustifolius] Length = 264 Score = 86.7 bits (213), Expect = 7e-19 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKVSSGSPWYGPDRVKYLGPFSGE 242 G+AVKLSPS ELG GR SMR+ T TKKVSSGSPWYGPDRVKYLGPFSGE Sbjct: 15 GQAVKLSPSAPELGVGRISMRK-TVTKKVSSGSPWYGPDRVKYLGPFSGE 63 >XP_016190537.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Arachis ipaensis] Length = 264 Score = 86.7 bits (213), Expect = 7e-19 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKVSSGSPWYGPDRVKYLGPFSGEP 245 GKAVKLSPS ELG GR SMR+ T TK+ +SGSPWYGPDRVKYLGPFSGEP Sbjct: 15 GKAVKLSPSAPELGVGRISMRK-TATKQATSGSPWYGPDRVKYLGPFSGEP 64 >BAH70299.1 chlorophyll a/b binding protein [Vicia cinerea] Length = 266 Score = 86.3 bits (212), Expect = 1e-18 Identities = 41/52 (78%), Positives = 45/52 (86%), Gaps = 1/52 (1%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKV-SSGSPWYGPDRVKYLGPFSGEP 245 GK VKL+PS ELGA RF+ R++ TTKKV SSGSPWYGPDRVKYLGPFSGEP Sbjct: 15 GKPVKLTPSSQELGASRFTTRKSATTKKVASSGSPWYGPDRVKYLGPFSGEP 66 >XP_018819730.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Juglans regia] Length = 264 Score = 85.5 bits (210), Expect = 2e-18 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKVSSGSPWYGPDRVKYLGPFSGEP 245 GKAVKL+PS ELG GR +MR+AT+ K VSSGSPWYGPDRVKYLGPFSGEP Sbjct: 15 GKAVKLAPSTPELGVGRVTMRKATS-KSVSSGSPWYGPDRVKYLGPFSGEP 64 >XP_015967983.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Arachis duranensis] XP_016204416.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Arachis ipaensis] Length = 264 Score = 85.5 bits (210), Expect = 2e-18 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKVSSGSPWYGPDRVKYLGPFSGEP 245 G+A+KLSPS ELG GR +MR+A T K+VSSGSPWYGPDRVKYLGPFSGEP Sbjct: 15 GQAIKLSPSNPELGVGRVTMRKAAT-KQVSSGSPWYGPDRVKYLGPFSGEP 64 >XP_015957489.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Arachis duranensis] Length = 264 Score = 85.5 bits (210), Expect = 2e-18 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKVSSGSPWYGPDRVKYLGPFSGEP 245 GKAVKLSPS ELG GR SMR+ T TK+ +SGSPWYGPDRVKYLGPFSGEP Sbjct: 15 GKAVKLSPSVPELGVGRISMRK-TATKQATSGSPWYGPDRVKYLGPFSGEP 64 >XP_013450965.1 light-harvesting complex I chlorophyll A/B-binding protein [Medicago truncatula] KEH25005.1 light-harvesting complex I chlorophyll A/B-binding protein [Medicago truncatula] Length = 265 Score = 85.5 bits (210), Expect = 2e-18 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKVSSGSPWYGPDRVKYLGPFSGE 242 GKA+KLSPS ++G GR +MR+ATT K V SGSPWYGPDRVKYLGPFSGE Sbjct: 15 GKAIKLSPSTQDIGVGRVTMRKATTKKSVPSGSPWYGPDRVKYLGPFSGE 64 >AFK39586.1 unknown [Medicago truncatula] Length = 265 Score = 85.5 bits (210), Expect = 2e-18 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKVSSGSPWYGPDRVKYLGPFSGE 242 GKA+KLSPS ++G GR +MR+ATT K V SGSPWYGPDRVKYLGPFSGE Sbjct: 15 GKAIKLSPSTQDIGVGRVTMRKATTKKSVPSGSPWYGPDRVKYLGPFSGE 64 >AAR10886.1 chlorophyll a/b binding protein [Trifolium pratense] Length = 266 Score = 85.5 bits (210), Expect = 2e-18 Identities = 40/52 (76%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKV-SSGSPWYGPDRVKYLGPFSGEP 245 GK VKL+PS ELG +F+MR+ TTKKV SSGSPWYGPDRVKYLGPFSGEP Sbjct: 15 GKPVKLTPSSQELGVAKFTMRKGATTKKVASSGSPWYGPDRVKYLGPFSGEP 66 >P07371.1 RecName: Full=Chlorophyll a-b binding protein AB80, chloroplastic; AltName: Full=LHCII type I CAB-AB80; Short=LHCP; Flags: Precursor AAA63413.1 cab precursor [Pisum sativum] AAA33651.1 polypeptide 15 precursor [Pisum sativum] prf||1006296A protein,chlorophyll a/b binding Length = 269 Score = 84.7 bits (208), Expect = 4e-18 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 1/51 (1%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKV-SSGSPWYGPDRVKYLGPFSGE 242 GK +KL+PS ELGA RF+MR++ TTKKV SSGSPWYGPDRVKYLGPFSGE Sbjct: 18 GKQLKLNPSSQELGAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGE 68 >XP_011045092.1 PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Populus euphratica] Length = 263 Score = 84.3 bits (207), Expect = 5e-18 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKVSSGSPWYGPDRVKYLGPFSGEP 245 GKAVKL+PS +E+G GR SMR+ TTK V SGSPWYGPDRVKYLGPFSGEP Sbjct: 15 GKAVKLNPSSSEIGNGRISMRK--TTKPVPSGSPWYGPDRVKYLGPFSGEP 63 >ABN49454.2 chloroplast chlorophyll a/b binding protein [Pisum sativum] Length = 266 Score = 84.3 bits (207), Expect = 6e-18 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKV-SSGSPWYGPDRVKYLGPFSGE 242 GK VKL+PS ELG RF+MR++ TTKKV SSGSPWYGPDRVKYLGPFSGE Sbjct: 15 GKPVKLNPSSQELGGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGE 65 >AAW31511.1 light-harvesting chlorophyll-a/b binding protein Lhcb1 [Pisum sativum] Length = 266 Score = 84.3 bits (207), Expect = 6e-18 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKV-SSGSPWYGPDRVKYLGPFSGE 242 GK VKL+PS ELG RF+MR++ TTKKV SSGSPWYGPDRVKYLGPFSGE Sbjct: 15 GKPVKLNPSSQELGGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGE 65 >XP_013450966.1 light-harvesting complex I chlorophyll A/B-binding protein [Medicago truncatula] KEH25006.1 light-harvesting complex I chlorophyll A/B-binding protein [Medicago truncatula] Length = 265 Score = 84.0 bits (206), Expect = 8e-18 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKVSSGSPWYGPDRVKYLGPFSGE 242 GKA+KLSPS ++G GR +MR+ TT K V SGSPWYGPDRVKYLGPFSGE Sbjct: 15 GKAIKLSPSTQDIGVGRVTMRKTTTKKSVPSGSPWYGPDRVKYLGPFSGE 64 >GAU43953.1 hypothetical protein TSUD_284600 [Trifolium subterraneum] Length = 267 Score = 84.0 bits (206), Expect = 8e-18 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = +3 Query: 93 GKAVKLSPSGAELGAGRFSMRRATTTKKVSSGSPWYGPDRVKYLGPFSGE 242 GKA+KLSPS +LG GR +MR+ TT K V SGSPWYGPDRVKYLGPFSGE Sbjct: 17 GKAIKLSPSTPDLGMGRVTMRKTTTKKTVPSGSPWYGPDRVKYLGPFSGE 66