BLASTX nr result
ID: Lithospermum23_contig00040271
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00040271 (257 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB50092.1 hypothetical protein B456_008G153400 [Gossypium raimo... 57 3e-08 XP_010094300.1 hypothetical protein L484_003489 [Morus notabilis... 52 2e-06 >KJB50092.1 hypothetical protein B456_008G153400 [Gossypium raimondii] Length = 131 Score = 56.6 bits (135), Expect = 3e-08 Identities = 31/67 (46%), Positives = 41/67 (61%) Frame = -2 Query: 202 MNTLVRNTTLGLSRRGDDYEPLDQSGDDYDEKGSNYFSRPKYHHHKNQMNILHSVSYRLD 23 MN+LVRN T SRR D YE LDQSG+ +E Y + K H +++ S+SYR D Sbjct: 1 MNSLVRNATSNFSRRLDGYELLDQSGETREENPPQYRTSSKRRPH----SVVASLSYRRD 56 Query: 22 RARKRHV 2 RA+KR + Sbjct: 57 RAKKRQI 63 >XP_010094300.1 hypothetical protein L484_003489 [Morus notabilis] EXB55632.1 hypothetical protein L484_003489 [Morus notabilis] Length = 133 Score = 52.0 bits (123), Expect = 2e-06 Identities = 31/68 (45%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Frame = -2 Query: 202 MNTLVRNTTLGLSRRGDDYEPLDQSGD-DYDEKGSNYFSRPKYHHHKNQMNILHSVSYRL 26 MNTLVR+TT LSRR D YEPLD D + + G FS+ K H+ + +S SYR Sbjct: 1 MNTLVRSTTASLSRRFDGYEPLDHDHDHHHHQPGWRAFSKRKKESHR----MPYSRSYRN 56 Query: 25 DRARKRHV 2 +RA+ R + Sbjct: 57 ERAKHRRI 64