BLASTX nr result
ID: Lithospermum23_contig00040002
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00040002 (466 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010062371.1 PREDICTED: probable protein phosphatase 2C 2 [Euc... 57 9e-07 XP_006376177.1 hypothetical protein POPTR_0013s10540g [Populus t... 55 4e-06 XP_011004862.1 PREDICTED: probable protein phosphatase 2C 74, pa... 55 6e-06 XP_011012742.1 PREDICTED: probable protein phosphatase 2C 74 [Po... 55 7e-06 >XP_010062371.1 PREDICTED: probable protein phosphatase 2C 2 [Eucalyptus grandis] Length = 452 Score = 57.4 bits (137), Expect = 9e-07 Identities = 36/96 (37%), Positives = 51/96 (53%), Gaps = 12/96 (12%) Frame = +2 Query: 215 GIHQRKDEVVNRDMVTPIKA----------KEESNLIRNRPPPLIVPGS-PALGSSAGE- 358 G+H + +N + T + A K +N +R RP LI+P + PAL Sbjct: 127 GLHDVRPREINSEAATDVPASPAQRLIAGEKVSANKLRKRPARLILPENFPALELGCERL 186 Query: 359 NKMGGEDIEMEGRDYNVASKKGRRKVMEDAHSVIVD 466 K ++ E+EGRDY + SKKGRR VMED++ V VD Sbjct: 187 KKRENKEFEVEGRDYCLVSKKGRRDVMEDSYGVTVD 222 >XP_006376177.1 hypothetical protein POPTR_0013s10540g [Populus trichocarpa] ERP53974.1 hypothetical protein POPTR_0013s10540g [Populus trichocarpa] Length = 446 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/59 (42%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = +2 Query: 293 IRNRPPPLIVPG-SPALGSSAGENKMGGEDIEMEGRDYNVASKKGRRKVMEDAHSVIVD 466 ++ RP L+VP SP + S + K+ ++ E++GRD+ +ASKKGRR+VMED + +++D Sbjct: 153 MKKRPGRLVVPEYSPVVEFSRADRKLENKEFEVQGRDFFLASKKGRREVMEDGYGIMID 211 >XP_011004862.1 PREDICTED: probable protein phosphatase 2C 74, partial [Populus euphratica] Length = 284 Score = 54.7 bits (130), Expect = 6e-06 Identities = 25/59 (42%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = +2 Query: 293 IRNRPPPLIVPG-SPALGSSAGENKMGGEDIEMEGRDYNVASKKGRRKVMEDAHSVIVD 466 ++ RP L+VP SP + S + K+ ++ E++GRD+ +ASKKGRR+VMED + +++D Sbjct: 64 LKKRPGRLVVPEYSPIVEFSRVDRKLENKEFEVQGRDFYLASKKGRREVMEDGYGIMID 122 >XP_011012742.1 PREDICTED: probable protein phosphatase 2C 74 [Populus euphratica] Length = 357 Score = 54.7 bits (130), Expect = 7e-06 Identities = 25/59 (42%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = +2 Query: 293 IRNRPPPLIVPG-SPALGSSAGENKMGGEDIEMEGRDYNVASKKGRRKVMEDAHSVIVD 466 ++ RP L+VP SP + S + K+ ++ E++GRD+ +ASKKGRR+VMED + +++D Sbjct: 64 LKKRPGRLVVPEYSPIVEFSRVDRKLENKEFEVQGRDFYLASKKGRREVMEDGYGIMID 122