BLASTX nr result
ID: Lithospermum23_contig00039775
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00039775 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009630538.1 PREDICTED: pentatricopeptide repeat-containing pr... 170 7e-48 XP_016551807.1 PREDICTED: pentatricopeptide repeat-containing pr... 169 9e-48 XP_006342434.1 PREDICTED: pentatricopeptide repeat-containing pr... 169 2e-47 XP_015059941.1 PREDICTED: pentatricopeptide repeat-containing pr... 168 2e-47 XP_004253182.1 PREDICTED: pentatricopeptide repeat-containing pr... 168 2e-47 CDP22212.1 unnamed protein product, partial [Coffea canephora] 164 4e-46 XP_009804752.1 PREDICTED: pentatricopeptide repeat-containing pr... 164 7e-46 CDP14502.1 unnamed protein product [Coffea canephora] 164 1e-45 XP_011087234.1 PREDICTED: pentatricopeptide repeat-containing pr... 163 3e-45 XP_019257370.1 PREDICTED: pentatricopeptide repeat-containing pr... 162 3e-45 XP_015571853.1 PREDICTED: pentatricopeptide repeat-containing pr... 159 4e-44 GAV81814.1 PPR domain-containing protein/PPR_2 domain-containing... 158 8e-44 XP_017189209.1 PREDICTED: pentatricopeptide repeat-containing pr... 154 4e-43 XP_019151286.1 PREDICTED: pentatricopeptide repeat-containing pr... 157 4e-43 KZV34703.1 pentatricopeptide repeat-containing protein mitochond... 156 4e-43 XP_018829217.1 PREDICTED: pentatricopeptide repeat-containing pr... 155 1e-42 XP_019107531.1 PREDICTED: pentatricopeptide repeat-containing pr... 154 2e-42 XP_012074714.1 PREDICTED: pentatricopeptide repeat-containing pr... 155 2e-42 XP_010536458.1 PREDICTED: pentatricopeptide repeat-containing pr... 155 2e-42 XP_006384866.1 hypothetical protein POPTR_0004s21780g [Populus t... 154 3e-42 >XP_009630538.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] XP_009630539.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] XP_016494488.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016494497.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016494504.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016494510.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016494514.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_018621821.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] XP_018621822.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] Length = 659 Score = 170 bits (430), Expect = 7e-48 Identities = 79/90 (87%), Positives = 87/90 (96%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMIIG+AQNGFSRKALELF+ MKVS +KPNYIT+LGVLFACSHAGLVEDGQ YFHS Sbjct: 354 ISWSTMIIGYAQNGFSRKALELFKEMKVSGIKPNYITVLGVLFACSHAGLVEDGQYYFHS 413 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKL+GIDPGREHYGCMVDLLGR+G+LD+A Sbjct: 414 MKKLFGIDPGREHYGCMVDLLGRSGKLDEA 443 >XP_016551807.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Capsicum annuum] XP_016551808.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Capsicum annuum] Length = 654 Score = 169 bits (429), Expect = 9e-48 Identities = 79/90 (87%), Positives = 86/90 (95%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMIIG+AQNGFSRKALELF MKVS +KPNYIT+LGVLFACSHAGLVEDGQ YFHS Sbjct: 349 ISWSTMIIGYAQNGFSRKALELFNEMKVSGIKPNYITVLGVLFACSHAGLVEDGQYYFHS 408 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKL+GIDPGREHYGCMVDLLGR+G+LD+A Sbjct: 409 MKKLFGIDPGREHYGCMVDLLGRSGKLDEA 438 >XP_006342434.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Solanum tuberosum] XP_015162048.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Solanum tuberosum] Length = 654 Score = 169 bits (427), Expect = 2e-47 Identities = 78/90 (86%), Positives = 87/90 (96%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMIIG+AQNGFSRKALELF+ MKVS ++PNYIT+LGVLFACSHAGLVEDGQ YFHS Sbjct: 349 ISWSTMIIGYAQNGFSRKALELFKEMKVSGIRPNYITVLGVLFACSHAGLVEDGQYYFHS 408 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKL+GIDPGREHYGCMVDLLGR+G+LD+A Sbjct: 409 MKKLFGIDPGREHYGCMVDLLGRSGKLDEA 438 >XP_015059941.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Solanum pennellii] Length = 654 Score = 168 bits (426), Expect = 2e-47 Identities = 78/90 (86%), Positives = 87/90 (96%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMIIG+AQNGFSRKALELF+ MKVS ++PNYIT+LGVLFACSHAGLVEDGQ YFHS Sbjct: 349 ISWSTMIIGYAQNGFSRKALELFKEMKVSGIRPNYITVLGVLFACSHAGLVEDGQFYFHS 408 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKL+GIDPGREHYGCMVDLLGR+G+LD+A Sbjct: 409 MKKLFGIDPGREHYGCMVDLLGRSGKLDEA 438 >XP_004253182.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Solanum lycopersicum] Length = 654 Score = 168 bits (426), Expect = 2e-47 Identities = 78/90 (86%), Positives = 87/90 (96%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMIIG+AQNGFSRKALELF+ MKVS ++PNYIT+LGVLFACSHAGLVEDGQ YFHS Sbjct: 349 ISWSTMIIGYAQNGFSRKALELFKEMKVSGIRPNYITVLGVLFACSHAGLVEDGQFYFHS 408 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKL+GIDPGREHYGCMVDLLGR+G+LD+A Sbjct: 409 MKKLFGIDPGREHYGCMVDLLGRSGKLDEA 438 >CDP22212.1 unnamed protein product, partial [Coffea canephora] Length = 557 Score = 164 bits (414), Expect = 4e-46 Identities = 76/90 (84%), Positives = 86/90 (95%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMI+G AQNGFSR+ALELF+AM VS++KPN+IT+LGVLFACSHAGLV+DG+ YF S Sbjct: 252 ISWSTMIMGLAQNGFSRRALELFKAMAVSKIKPNHITILGVLFACSHAGLVDDGRYYFRS 311 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKLYGIDPGREHYGCMVDLLGRAGRLD+A Sbjct: 312 MKKLYGIDPGREHYGCMVDLLGRAGRLDEA 341 >XP_009804752.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_009804753.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_009804754.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_009804755.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_009804757.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_009804758.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_009804759.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_016449016.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016449017.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016449018.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016449019.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016449020.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] Length = 659 Score = 164 bits (416), Expect = 7e-46 Identities = 77/90 (85%), Positives = 85/90 (94%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMIIG+AQNGFSRKALEL + MKVS +KPNYIT+LGVLFACSHAGLVEDGQ YF S Sbjct: 354 ISWSTMIIGYAQNGFSRKALELLKEMKVSGIKPNYITVLGVLFACSHAGLVEDGQYYFRS 413 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKL+GIDPGREHYGCMVDLLGR+G+LD+A Sbjct: 414 MKKLFGIDPGREHYGCMVDLLGRSGKLDEA 443 >CDP14502.1 unnamed protein product [Coffea canephora] Length = 669 Score = 164 bits (414), Expect = 1e-45 Identities = 76/90 (84%), Positives = 86/90 (95%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMI+G AQNGFSR+ALELF+AM VS++KPN+IT+LGVLFACSHAGLV+DG+ YF S Sbjct: 364 ISWSTMIMGLAQNGFSRRALELFKAMAVSKIKPNHITILGVLFACSHAGLVDDGRYYFRS 423 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKLYGIDPGREHYGCMVDLLGRAGRLD+A Sbjct: 424 MKKLYGIDPGREHYGCMVDLLGRAGRLDEA 453 >XP_011087234.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Sesamum indicum] XP_011087235.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Sesamum indicum] XP_011087237.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Sesamum indicum] Length = 661 Score = 163 bits (412), Expect = 3e-45 Identities = 77/90 (85%), Positives = 83/90 (92%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMIIGFAQNG+SRKALELFE MK S KPNYIT+LGVLFACSHAGLV+DGQ YF S Sbjct: 356 ISWSTMIIGFAQNGYSRKALELFEEMKASGTKPNYITILGVLFACSHAGLVKDGQYYFES 415 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MK LYGIDPGREHYGCMVDLLGRAG+L++A Sbjct: 416 MKMLYGIDPGREHYGCMVDLLGRAGKLEEA 445 >XP_019257370.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana attenuata] XP_019257371.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana attenuata] XP_019257372.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana attenuata] OIS96339.1 pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 659 Score = 162 bits (411), Expect = 3e-45 Identities = 77/90 (85%), Positives = 84/90 (93%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMIIG AQNGFSRKALELF+ MKVS +KPNYIT+LGVLFACSHAGLV DGQ YF S Sbjct: 354 ISWSTMIIGCAQNGFSRKALELFKEMKVSGIKPNYITVLGVLFACSHAGLVADGQYYFRS 413 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKL+GIDPGREHYGCMVDLLGR+G+LD+A Sbjct: 414 MKKLFGIDPGREHYGCMVDLLGRSGKLDEA 443 >XP_015571853.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Ricinus communis] Length = 646 Score = 159 bits (403), Expect = 4e-44 Identities = 74/90 (82%), Positives = 84/90 (93%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMI GFAQNG+SR+AL+LFE+MKVS KPNYIT+LGVLFACSHAGL+E G +YF S Sbjct: 341 ISWSTMIAGFAQNGYSREALKLFESMKVSGTKPNYITILGVLFACSHAGLLEAGWHYFRS 400 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKL+GIDPGREHYGCM+DLLGRAG+LDDA Sbjct: 401 MKKLFGIDPGREHYGCMIDLLGRAGKLDDA 430 >GAV81814.1 PPR domain-containing protein/PPR_2 domain-containing protein/DYW_deaminase domain-containing protein [Cephalotus follicularis] Length = 582 Score = 158 bits (399), Expect = 8e-44 Identities = 73/90 (81%), Positives = 84/90 (93%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMI GFAQNG+SR+AL LFE+MKVS +PNYIT++GVLFACSHAGLVEDG ++F S Sbjct: 277 ISWSTMIAGFAQNGYSREALRLFESMKVSGTRPNYITIVGVLFACSHAGLVEDGWHHFQS 336 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKLYGI+PGREHYGCMVDLLGRAG+LD+A Sbjct: 337 MKKLYGIEPGREHYGCMVDLLGRAGKLDEA 366 >XP_017189209.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Malus domestica] Length = 435 Score = 154 bits (388), Expect = 4e-43 Identities = 71/90 (78%), Positives = 82/90 (91%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMI G AQNGFS++AL LFE MKVS VKPNYIT+LGVLFACSHAGL+EDG YF + Sbjct: 130 ISWSTMIAGLAQNGFSQEALRLFEQMKVSGVKPNYITLLGVLFACSHAGLLEDGWYYFQN 189 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MK+L+GIDPGREHYGC++DLLGRAG+LD+A Sbjct: 190 MKQLFGIDPGREHYGCVIDLLGRAGKLDEA 219 >XP_019151286.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Ipomoea nil] Length = 672 Score = 157 bits (397), Expect = 4e-43 Identities = 75/90 (83%), Positives = 82/90 (91%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMI+G AQNGFS+KALELFE MK S +KPNYIT+LGVLFACSHAGLVEDGQ YF S Sbjct: 367 ISWSTMIMGLAQNGFSKKALELFEEMKSSGMKPNYITVLGVLFACSHAGLVEDGQYYFRS 426 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MK L+GIDP REHYGCMVDLLGRAG+LD+A Sbjct: 427 MKTLFGIDPVREHYGCMVDLLGRAGKLDEA 456 >KZV34703.1 pentatricopeptide repeat-containing protein mitochondrial [Dorcoceras hygrometricum] Length = 585 Score = 156 bits (394), Expect = 4e-43 Identities = 72/90 (80%), Positives = 81/90 (90%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMIIGFAQNG+S+K+L LFE MK S +PNYIT+LGVLFACSHAGLVEDG+ YF S Sbjct: 280 ISWSTMIIGFAQNGYSKKSLVLFEEMKASGTRPNYITILGVLFACSHAGLVEDGEQYFKS 339 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MK LYGIDPGREHYGCM+DLLGRAG+L +A Sbjct: 340 MKMLYGIDPGREHYGCMIDLLGRAGKLKEA 369 >XP_018829217.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Juglans regia] Length = 640 Score = 155 bits (392), Expect = 1e-42 Identities = 73/90 (81%), Positives = 81/90 (90%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMI G AQNGFSR+AL LF++MK S VKPNYIT+LGVLFACSHAGLVEDG YF S Sbjct: 335 ISWSTMIAGLAQNGFSREALNLFQSMKESGVKPNYITILGVLFACSHAGLVEDGWYYFQS 394 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKL+GIDPGREHYGC++DLLGRAG+LD A Sbjct: 395 MKKLFGIDPGREHYGCIIDLLGRAGKLDQA 424 >XP_019107531.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X2 [Beta vulgaris subsp. vulgaris] KMT01589.1 hypothetical protein BVRB_9g215850 [Beta vulgaris subsp. vulgaris] Length = 530 Score = 154 bits (388), Expect = 2e-42 Identities = 71/90 (78%), Positives = 81/90 (90%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMIIG AQNGFSR+AL LFE MK+S PNYIT++GVLFACSHAGL+E+G YF S Sbjct: 225 ISWSTMIIGLAQNGFSREALNLFEKMKLSGTGPNYITIVGVLFACSHAGLLEEGWYYFRS 284 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKK++GIDPGREHYGCM+DLLGRAG+LDDA Sbjct: 285 MKKIFGIDPGREHYGCMIDLLGRAGKLDDA 314 >XP_012074714.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Jatropha curcas] KDP47022.1 hypothetical protein JCGZ_10749 [Jatropha curcas] Length = 632 Score = 155 bits (391), Expect = 2e-42 Identities = 71/90 (78%), Positives = 82/90 (91%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMI G AQNG+SR+ALELFE+MKVS +KPNYIT+LGVLFACSHAGL+E G YF S Sbjct: 327 ISWSTMIAGLAQNGYSREALELFESMKVSGIKPNYITILGVLFACSHAGLLESGWYYFRS 386 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKL+G+DPGREHYGCM+DLLGRAG+L+ A Sbjct: 387 MKKLFGVDPGREHYGCMIDLLGRAGKLEHA 416 >XP_010536458.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Tarenaya hassleriana] XP_010536459.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Tarenaya hassleriana] XP_010536461.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Tarenaya hassleriana] XP_010536462.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Tarenaya hassleriana] XP_010536463.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Tarenaya hassleriana] Length = 656 Score = 155 bits (391), Expect = 2e-42 Identities = 72/90 (80%), Positives = 80/90 (88%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMI+G AQNG+S +AL+LF+ MK S +PNYIT+LGVLFACSHAGLVEDG YF Sbjct: 351 ISWSTMIVGLAQNGYSEEALKLFDHMKASGTRPNYITILGVLFACSHAGLVEDGWYYFRW 410 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MKKLYGIDPGREHYGCM+DLLGRAGRLDDA Sbjct: 411 MKKLYGIDPGREHYGCMIDLLGRAGRLDDA 440 >XP_006384866.1 hypothetical protein POPTR_0004s21780g [Populus trichocarpa] ERP62663.1 hypothetical protein POPTR_0004s21780g [Populus trichocarpa] Length = 571 Score = 154 bits (388), Expect = 3e-42 Identities = 69/90 (76%), Positives = 83/90 (92%) Frame = +1 Query: 1 ISWSTMIIGFAQNGFSRKALELFEAMKVSRVKPNYITMLGVLFACSHAGLVEDGQNYFHS 180 ISWSTMI G AQNG+S++AL+LFE+MKV +KPNY+T++GVLFACSHAGLVE+G YFHS Sbjct: 266 ISWSTMIAGLAQNGYSKEALKLFESMKVLGIKPNYVTIVGVLFACSHAGLVEEGLYYFHS 325 Query: 181 MKKLYGIDPGREHYGCMVDLLGRAGRLDDA 270 MK+L+GIDPGREHYGCM+DLLGRAGRL +A Sbjct: 326 MKELFGIDPGREHYGCMIDLLGRAGRLSEA 355