BLASTX nr result
ID: Lithospermum23_contig00039654
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00039654 (293 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010036631.1 PREDICTED: subtilisin-like protease SBT2.3 [Eucal... 53 7e-06 >XP_010036631.1 PREDICTED: subtilisin-like protease SBT2.3 [Eucalyptus grandis] KCW48241.1 hypothetical protein EUGRSUZ_K01967 [Eucalyptus grandis] Length = 845 Score = 52.8 bits (125), Expect = 7e-06 Identities = 32/78 (41%), Positives = 41/78 (52%), Gaps = 1/78 (1%) Frame = -3 Query: 231 SWGQETDEEDVNAVYIVTLKQAPSVRTHNVF-DEXXXXXXXXXXXXXXXXXXKPSNSSRT 55 +W Q + E + AVYIVTLKQAP V + V E + N+SR+ Sbjct: 20 TWCQNSSSEAITAVYIVTLKQAPVVHDYGVLKKETNVFRHGGSGKSNRMDKARHRNTSRS 79 Query: 54 GRSYASRVSRVHDSLLKK 1 G S S ++RVHDSLLKK Sbjct: 80 GGSSGSYIARVHDSLLKK 97