BLASTX nr result
ID: Lithospermum23_contig00039529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00039529 (502 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP09778.1 unnamed protein product [Coffea canephora] 59 2e-08 >CDP09778.1 unnamed protein product [Coffea canephora] Length = 84 Score = 58.5 bits (140), Expect = 2e-08 Identities = 29/73 (39%), Positives = 41/73 (56%) Frame = +1 Query: 34 MGTQYSCMSCFLVLVILAFSQLSKCQNSYGVNIKGTEQRSTTYFQSRYSWRPHAPSPERA 213 M QY +S ++V+L SQLS ++ + K E+R T QS+ SW H P+P + Sbjct: 1 MAIQYPAISFMFIMVMLTLSQLSSGRSIHEFTYKTKEERFTREVQSQISWNSHVPAPGES 60 Query: 214 KNEAYMNYRVSHR 252 +N NYRVSHR Sbjct: 61 RNGDDPNYRVSHR 73