BLASTX nr result
ID: Lithospermum23_contig00039170
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00039170 (227 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU45923.1 hypothetical protein MIMGU_mgv1a018357mg [Erythranthe... 49 7e-06 >EYU45923.1 hypothetical protein MIMGU_mgv1a018357mg [Erythranthe guttata] Length = 67 Score = 48.5 bits (114), Expect = 7e-06 Identities = 28/44 (63%), Positives = 31/44 (70%), Gaps = 3/44 (6%) Frame = +3 Query: 105 MEKMKQQC-NKNGGFSTSSIKRKGN--GFTRKCASLVKQQRGRI 227 M +MKQ+ N N G +SS KR N GFTRKCASLVKQQR RI Sbjct: 1 MAEMKQKTKNSNNGVYSSSSKRSNNNNGFTRKCASLVKQQRARI 44