BLASTX nr result
ID: Lithospermum23_contig00039122
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00039122 (504 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP09074.1 unnamed protein product [Coffea canephora] 57 2e-06 >CDP09074.1 unnamed protein product [Coffea canephora] Length = 749 Score = 57.0 bits (136), Expect = 2e-06 Identities = 35/108 (32%), Positives = 59/108 (54%), Gaps = 1/108 (0%) Frame = -1 Query: 321 MDSHSNNLPDYYNGFRFNNETPLIVSHQSSLNGSASYFEKSSFDQGFMN-NPYASNLEKS 145 MD N LPD NGF+F +E L +S + F ++ D F++ + ++ Sbjct: 1 MDPRFNQLPDSVNGFKFEDEIVLPSFEESPNLLNGFKFGDNALDLNFVDTSSFSPTPGTG 60 Query: 144 SLNMNKYGSQGIGSSNDHEPTDPMIKYINQALLEDSTEERSSVLYDPL 1 +L GS + S +D + +DP+++Y+NQ LLE++ EE+ S+ DPL Sbjct: 61 NLPAFSTGSSEVDSPDDGD-SDPVLRYLNQILLEENMEEKPSMFPDPL 107