BLASTX nr result
ID: Lithospermum23_contig00039088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00039088 (402 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019161688.1 PREDICTED: probable leucine-rich repeat receptor-... 52 9e-06 >XP_019161688.1 PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770 [Ipomoea nil] Length = 967 Score = 52.4 bits (124), Expect(2) = 9e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 208 LFLLLVGLGIYAVQQKKRAEKAINLSNPFGN 116 L LLLVGLGIYAVQQKKRAE+AI +S PFG+ Sbjct: 567 LVLLLVGLGIYAVQQKKRAERAIGMSRPFGS 597 Score = 24.3 bits (51), Expect(2) = 9e-06 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 Query: 44 SWAPSLSYSGGAPQ 3 SWAPS SGG PQ Sbjct: 597 SWAPSGKDSGGVPQ 610