BLASTX nr result
ID: Lithospermum23_contig00039075
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00039075 (293 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008456737.1 PREDICTED: type IV inositol polyphosphate 5-phosp... 55 8e-07 XP_008456733.1 PREDICTED: type IV inositol polyphosphate 5-phosp... 55 8e-07 XP_004140952.1 PREDICTED: type I inositol 1,4,5-trisphosphate 5-... 55 8e-07 XP_011044289.1 PREDICTED: type I inositol 1,4,5-trisphosphate 5-... 53 5e-06 >XP_008456737.1 PREDICTED: type IV inositol polyphosphate 5-phosphatase 3 isoform X4 [Cucumis melo] Length = 606 Score = 55.5 bits (132), Expect = 8e-07 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 192 MGHHSVQQPQIFWPRVVVRKWLNINNKKTHYSAD 293 M H+S QPQ+FWPRVV+RKWLNI+ K++ YSAD Sbjct: 1 MRHNSKNQPQLFWPRVVLRKWLNISAKESDYSAD 34 >XP_008456733.1 PREDICTED: type IV inositol polyphosphate 5-phosphatase 3 isoform X2 [Cucumis melo] XP_008456734.1 PREDICTED: type IV inositol polyphosphate 5-phosphatase 3 isoform X2 [Cucumis melo] XP_008456735.1 PREDICTED: type IV inositol polyphosphate 5-phosphatase 3 isoform X2 [Cucumis melo] Length = 630 Score = 55.5 bits (132), Expect = 8e-07 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 192 MGHHSVQQPQIFWPRVVVRKWLNINNKKTHYSAD 293 M H+S QPQ+FWPRVV+RKWLNI+ K++ YSAD Sbjct: 1 MRHNSKNQPQLFWPRVVLRKWLNISAKESDYSAD 34 >XP_004140952.1 PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1 isoform X2 [Cucumis sativus] XP_011656619.1 PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1 isoform X2 [Cucumis sativus] KGN46110.1 hypothetical protein Csa_6G054330 [Cucumis sativus] Length = 630 Score = 55.5 bits (132), Expect = 8e-07 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +3 Query: 192 MGHHSVQQPQIFWPRVVVRKWLNINNKKTHYSAD 293 M H+S QPQ+FWPRVV+RKWLNI+ K++ YSAD Sbjct: 1 MRHNSKNQPQLFWPRVVLRKWLNISAKESDYSAD 34 >XP_011044289.1 PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1 isoform X2 [Populus euphratica] XP_011044290.1 PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1 isoform X2 [Populus euphratica] Length = 642 Score = 53.1 bits (126), Expect = 5e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = +3 Query: 192 MGHHSVQQPQIFWPRVVVRKWLNINNKKTHYSAD 293 M S Q+P++FWPRVVVRKWLNI++K + YSAD Sbjct: 1 MNSQSKQRPELFWPRVVVRKWLNISSKDSDYSAD 34