BLASTX nr result
ID: Lithospermum23_contig00038929
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00038929 (348 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAU23938.1 Adenosylhomocysteinase 2, partial [Noccaea caerulesce... 102 2e-25 CCQ38381.1 adenosyl-homocysteine hydrolase, partial [Schiedea la... 99 2e-25 BAF01736.1 adenosylhomocysteinase, partial [Arabidopsis thaliana] 100 4e-25 CCQ38404.1 adenosyl-homocysteine hydrolase, partial [Schiedea tr... 97 1e-24 KFK36282.1 hypothetical protein AALP_AA4G102500 [Arabis alpina] 99 3e-24 AFK46472.1 unknown [Lotus japonicus] 102 5e-24 XP_018464895.1 PREDICTED: adenosylhomocysteinase 2-like, partial... 101 7e-24 KFK36278.1 hypothetical protein AALP_AA4G101800 [Arabis alpina] 103 9e-24 CAH69227.1 putative adenosylhomocysteinase, partial [Nicotiana g... 100 9e-24 JAU09785.1 Adenosylhomocysteinase 1, partial [Noccaea caerulescens] 103 1e-23 JAU94844.1 Adenosylhomocysteinase 1, partial [Noccaea caerulescens] 103 1e-23 JAU66041.1 Adenosylhomocysteinase 1, partial [Noccaea caerulescens] 103 1e-23 JAU38635.1 Adenosylhomocysteinase 1, partial [Noccaea caerulescens] 103 1e-23 AQK49908.1 Adenosylhomocysteinase [Zea mays] 98 1e-23 XP_006414844.1 hypothetical protein EUTSA_v10024750mg [Eutrema s... 103 1e-23 XP_010466741.1 PREDICTED: adenosylhomocysteinase 2-like isoform ... 100 2e-23 BAT13922.1 Os11g0455500, partial [Oryza sativa Japonica Group] 100 2e-23 AAA33855.1 S-adenosylhomocysteine hydrolase [Petroselinum crispum] 99 2e-23 BAH57232.1 AT4G13940 [Arabidopsis thaliana] 100 4e-23 KFK39678.1 hypothetical protein AALP_AA3G275000 [Arabis alpina] 102 5e-23 >JAU23938.1 Adenosylhomocysteinase 2, partial [Noccaea caerulescens] JAU51688.1 Adenosylhomocysteinase 2, partial [Noccaea caerulescens] JAU67184.1 Adenosylhomocysteinase 2, partial [Noccaea caerulescens] JAU86576.1 Adenosylhomocysteinase 2, partial [Noccaea caerulescens] Length = 151 Score = 102 bits (253), Expect = 2e-25 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGARLTKLSKDQSDY+SIPIEGPYKP HYRY Sbjct: 103 YVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY 151 >CCQ38381.1 adenosyl-homocysteine hydrolase, partial [Schiedea laui] CCQ38382.1 adenosyl-homocysteine hydrolase, partial [Schiedea pentandra] CCQ38383.1 adenosyl-homocysteine hydrolase, partial [Schiedea jacobii] CCQ38384.1 adenosyl-homocysteine hydrolase, partial [Schiedea kaalae] CCQ38385.1 adenosyl-homocysteine hydrolase, partial [Schiedea kauaiensis] CCQ38386.1 adenosyl-homocysteine hydrolase, partial [Schiedea perlmanii] CCQ38387.1 adenosyl-homocysteine hydrolase, partial [Schiedea nuttallii] CCQ38388.1 adenosyl-homocysteine hydrolase, partial [Schiedea stellarioides] CCQ38389.1 adenosyl-homocysteine hydrolase, partial [Schiedea spergulina] CCQ38390.1 adenosyl-homocysteine hydrolase, partial [Schiedea kealiae] CCQ38391.1 adenosyl-homocysteine hydrolase, partial [Schiedea mannii] CCQ38392.1 adenosyl-homocysteine hydrolase, partial [Schiedea adamantis] CCQ38393.1 adenosyl-homocysteine hydrolase, partial [Schiedea menziesii] CCQ38394.1 adenosyl-homocysteine hydrolase, partial [Schiedea hookeri] CCQ38395.1 adenosyl-homocysteine hydrolase, partial [Schiedea sarmentosa] CCQ38396.1 adenosyl-homocysteine hydrolase, partial [Schiedea lydgatei] CCQ38397.1 adenosyl-homocysteine hydrolase, partial [Schiedea haleakalensis] CCQ38398.1 adenosyl-homocysteine hydrolase, partial [Schiedea ligustrina] CCQ38399.1 adenosyl-homocysteine hydrolase, partial [Schiedea salicaria] CCQ38400.1 adenosyl-homocysteine hydrolase, partial [Schiedea globosa] CCQ38401.1 adenosyl-homocysteine hydrolase, partial [Schiedea apokremnos] CCQ38402.1 adenosyl-homocysteine hydrolase, partial [Schiedea helleri] CCQ38403.1 adenosyl-homocysteine hydrolase, partial [Schiedea membranacea] CCQ38405.1 adenosyl-homocysteine hydrolase, partial [Schiedea obovata] CCQ38406.1 adenosyl-homocysteine hydrolase, partial [Schiedea viscosa] CCQ38407.1 adenosyl-homocysteine hydrolase, partial [Schiedea verticillata] Length = 50 Score = 99.0 bits (245), Expect = 2e-25 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGA+LTKL+KDQSDY+SIP+EGPYKP HYRY Sbjct: 2 YVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYLSIPVEGPYKPVHYRY 50 >BAF01736.1 adenosylhomocysteinase, partial [Arabidopsis thaliana] Length = 96 Score = 99.8 bits (247), Expect = 4e-25 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVA LHLGKLGARLTKLSKDQSDY+SIPIEGPYKP HYRY Sbjct: 48 YVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY 96 >CCQ38404.1 adenosyl-homocysteine hydrolase, partial [Schiedea trinervis] Length = 50 Score = 97.4 bits (241), Expect = 1e-24 Identities = 42/49 (85%), Positives = 48/49 (97%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGA+L+KL+KDQSDY+SIP+EGPYKP HYRY Sbjct: 2 YVLPKHLDEKVAALHLGKLGAKLSKLTKDQSDYLSIPVEGPYKPVHYRY 50 >KFK36282.1 hypothetical protein AALP_AA4G102500 [Arabis alpina] Length = 154 Score = 99.4 bits (246), Expect = 3e-24 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y LPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAH+RY Sbjct: 106 YGLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHHRY 154 >AFK46472.1 unknown [Lotus japonicus] Length = 290 Score = 102 bits (253), Expect = 5e-24 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGARLTKL KDQSDYISIPIEGPYKPAHYRY Sbjct: 242 YVLPKHLDEKVAALHLGKLGARLTKLRKDQSDYISIPIEGPYKPAHYRY 290 >XP_018464895.1 PREDICTED: adenosylhomocysteinase 2-like, partial [Raphanus sativus] Length = 264 Score = 101 bits (251), Expect = 7e-24 Identities = 45/49 (91%), Positives = 49/49 (100%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGA+LTKL+KDQSDY+SIPIEGPYKPAHYRY Sbjct: 216 YVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY 264 >KFK36278.1 hypothetical protein AALP_AA4G101800 [Arabis alpina] Length = 485 Score = 103 bits (258), Expect = 9e-24 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY Sbjct: 437 YVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 485 >CAH69227.1 putative adenosylhomocysteinase, partial [Nicotiana glauca] Length = 264 Score = 100 bits (250), Expect = 9e-24 Identities = 44/49 (89%), Positives = 49/49 (100%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGA+LTKLSKDQ+DYIS+P+EGPYKPAHYRY Sbjct: 216 YVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 264 >JAU09785.1 Adenosylhomocysteinase 1, partial [Noccaea caerulescens] Length = 506 Score = 103 bits (258), Expect = 1e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY Sbjct: 458 YVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 506 >JAU94844.1 Adenosylhomocysteinase 1, partial [Noccaea caerulescens] Length = 509 Score = 103 bits (258), Expect = 1e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY Sbjct: 461 YVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 509 >JAU66041.1 Adenosylhomocysteinase 1, partial [Noccaea caerulescens] Length = 511 Score = 103 bits (258), Expect = 1e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY Sbjct: 463 YVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 511 >JAU38635.1 Adenosylhomocysteinase 1, partial [Noccaea caerulescens] Length = 518 Score = 103 bits (258), Expect = 1e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY Sbjct: 470 YVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 518 >AQK49908.1 Adenosylhomocysteinase [Zea mays] Length = 154 Score = 97.8 bits (242), Expect = 1e-23 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGA+LTKL+K Q+DYIS+PIEGPYKPAHYRY Sbjct: 106 YVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY 154 >XP_006414844.1 hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum] ESQ56297.1 hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum] Length = 588 Score = 103 bits (258), Expect = 1e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY Sbjct: 540 YVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 588 >XP_010466741.1 PREDICTED: adenosylhomocysteinase 2-like isoform X2 [Camelina sativa] Length = 291 Score = 100 bits (250), Expect = 2e-23 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGARLTKLSKDQSDY+SIPIEGPYKPA+YRY Sbjct: 243 YVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY 291 >BAT13922.1 Os11g0455500, partial [Oryza sativa Japonica Group] Length = 256 Score = 99.8 bits (247), Expect = 2e-23 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGARLTKLSK Q+DYIS+P+EGPYKPAHYRY Sbjct: 208 YVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY 256 >AAA33855.1 S-adenosylhomocysteine hydrolase [Petroselinum crispum] Length = 227 Score = 99.0 bits (245), Expect = 2e-23 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+ PKHLDEKVAALHLGKLGA+LTKLSKDQ+DYIS+P+EGPYKPAHYRY Sbjct: 179 YVCPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 227 >BAH57232.1 AT4G13940 [Arabidopsis thaliana] Length = 291 Score = 99.8 bits (247), Expect = 4e-23 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVA LHLGKLGARLTKLSKDQSDY+SIPIEGPYKP HYRY Sbjct: 243 YVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY 291 >KFK39678.1 hypothetical protein AALP_AA3G275000 [Arabis alpina] Length = 485 Score = 102 bits (253), Expect = 5e-23 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -3 Query: 346 YILPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY 200 Y+LPKHLDEKVAALHLGKLGARLTKLSKDQSDY+SIPIEGPYKP HYRY Sbjct: 437 YVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY 485