BLASTX nr result
ID: Lithospermum23_contig00038583
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00038583 (379 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV26810.1 U-box domain-containing protein 35-like [Dorcoceras h... 56 1e-06 XP_012851305.1 PREDICTED: U-box domain-containing protein 35-lik... 55 4e-06 XP_012851304.1 PREDICTED: U-box domain-containing protein 35-lik... 55 4e-06 >KZV26810.1 U-box domain-containing protein 35-like [Dorcoceras hygrometricum] Length = 767 Score = 55.8 bits (133), Expect = 1e-06 Identities = 36/99 (36%), Positives = 52/99 (52%), Gaps = 9/99 (9%) Frame = +3 Query: 63 DFLRSPFTRNPGMNNNLDDLSFSNCDISF---------VQHHGRTKEPNMNSQMSNSSEP 215 D +RSPFTR N + D + + D+SF +H + ++ +M S++SNSS+ Sbjct: 236 DSIRSPFTRGNASNRSYGDFAALDTDLSFGSSGRPSTERMNHTQDQDMSMASRLSNSSDT 295 Query: 216 EKRMMFGSIFSSGKLPPETNNSLGALSSSGKQSSNASHS 332 E R GS FS + + N S G LSSS +S N S S Sbjct: 296 ENRSSIGSPFSHA-MSSDANYSFGILSSSSLESGNYSWS 333 >XP_012851305.1 PREDICTED: U-box domain-containing protein 35-like isoform X2 [Erythranthe guttata] Length = 784 Score = 54.7 bits (130), Expect = 4e-06 Identities = 42/114 (36%), Positives = 62/114 (54%), Gaps = 12/114 (10%) Frame = +3 Query: 63 DFLRSPFTRN--PGMNNNLDDLSF-SNCDISFVQHHGRTKE---PNMNSQM------SNS 206 D ++SPFTR N + +LS N DISFV + E P++ M SNS Sbjct: 219 DSIKSPFTRGNCKASNRSYGELSMPDNMDISFVSSVRPSNERMFPSLEQDMMMAPRLSNS 278 Query: 207 SEPEKRMMFGSIFSSGKLPPETNNSLGALSSSGKQSSNASHSLGTRSPETMSSD 368 S+ E R+ FGS FS+ + + NNS G SSS ++S N S S G++S + + ++ Sbjct: 279 SDTENRLSFGSPFSNAR-SSDANNSFGVCSSSSQESGNFSWS-GSQSLDDVEAE 330 >XP_012851304.1 PREDICTED: U-box domain-containing protein 35-like isoform X1 [Erythranthe guttata] Length = 785 Score = 54.7 bits (130), Expect = 4e-06 Identities = 42/114 (36%), Positives = 62/114 (54%), Gaps = 12/114 (10%) Frame = +3 Query: 63 DFLRSPFTRN--PGMNNNLDDLSF-SNCDISFVQHHGRTKE---PNMNSQM------SNS 206 D ++SPFTR N + +LS N DISFV + E P++ M SNS Sbjct: 220 DSIKSPFTRGNCKASNRSYGELSMPDNMDISFVSSVRPSNERMFPSLEQDMMMAPRLSNS 279 Query: 207 SEPEKRMMFGSIFSSGKLPPETNNSLGALSSSGKQSSNASHSLGTRSPETMSSD 368 S+ E R+ FGS FS+ + + NNS G SSS ++S N S S G++S + + ++ Sbjct: 280 SDTENRLSFGSPFSNAR-SSDANNSFGVCSSSSQESGNFSWS-GSQSLDDVEAE 331