BLASTX nr result
ID: Lithospermum23_contig00038581
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00038581 (278 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009049771.1 hypothetical protein (mitochondrion) [Capsicum an... 64 1e-10 YP_007516862.1 hypothetical protein GlmaxMp13 (mitochondrion) [G... 60 8e-09 AGC78982.1 hypothetical protein (mitochondrion) [Vicia faba] 56 9e-08 >YP_009049771.1 hypothetical protein (mitochondrion) [Capsicum annuum] AIG89953.1 hypothetical protein (mitochondrion) [Capsicum annuum] AIG90129.1 hypothetical protein (mitochondrion) [Capsicum annuum] Length = 146 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/37 (86%), Positives = 35/37 (94%), Gaps = 1/37 (2%) Frame = +1 Query: 61 SSSGTGPSIDHRAYSTLTEFILLKRNVKSAF-SCLSV 168 SSSGT PSIDHRAYSTLTEFILLKRNVKS+F SC+S+ Sbjct: 98 SSSGTAPSIDHRAYSTLTEFILLKRNVKSSFSSCISL 134 >YP_007516862.1 hypothetical protein GlmaxMp13 (mitochondrion) [Glycine max] AFR34339.1 hypothetical protein GlmaxMp13 (mitochondrion) [Glycine max] Length = 287 Score = 60.5 bits (145), Expect = 8e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 55 NWSSSGTGPSIDHRAYSTLTEFILLKRNVK 144 +WSSSGTGPSIDH AYSTLTEFILLKRNVK Sbjct: 100 DWSSSGTGPSIDHGAYSTLTEFILLKRNVK 129 >AGC78982.1 hypothetical protein (mitochondrion) [Vicia faba] Length = 142 Score = 55.8 bits (133), Expect = 9e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +1 Query: 61 SSSGTGPSIDHRAYSTLTEFILLKRNVK 144 SSSGTGPSIDH AYSTLTEFILLKRNVK Sbjct: 17 SSSGTGPSIDHGAYSTLTEFILLKRNVK 44