BLASTX nr result
ID: Lithospermum23_contig00038189
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00038189 (417 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS74167.1 hypothetical protein M569_00588, partial [Genlisea au... 91 1e-21 KQK20681.1 hypothetical protein BRADI_1g63372 [Brachypodium dist... 79 5e-17 KXG18792.1 hypothetical protein SORBI_K033500 [Sorghum bicolor] 62 3e-10 OEL35491.1 hypothetical protein BAE44_0003490 [Dichanthelium oli... 55 6e-08 OAY33821.1 hypothetical protein MANES_13G128000 [Manihot esculenta] 50 9e-06 >EPS74167.1 hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 90.9 bits (224), Expect = 1e-21 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 3 RIAGIEPASLAWKARGYSRRRFSILNVSNSKPNMKLWFHSAPLWK 137 R+AGIEPASLAWKA+GYSRRRFS L+VSNSKPNMKLWFHSAPLW+ Sbjct: 13 RVAGIEPASLAWKAKGYSRRRFSSLSVSNSKPNMKLWFHSAPLWR 57 >KQK20681.1 hypothetical protein BRADI_1g63372 [Brachypodium distachyon] Length = 59 Score = 79.0 bits (193), Expect = 5e-17 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = +3 Query: 3 RIAGIEPASLAWKARGYSRRRFSILNVSNSKPNMKLWFHSAPLW 134 R+AGIEPASLAWKARGYSRR I NVSNSKPNMK FHSAPLW Sbjct: 3 RVAGIEPASLAWKARGYSRRWLIIYNVSNSKPNMKFSFHSAPLW 46 >KXG18792.1 hypothetical protein SORBI_K033500 [Sorghum bicolor] Length = 51 Score = 61.6 bits (148), Expect = 3e-10 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 3 RIAGIEPASLAWKARGYSRRRFSILNVSNSKPNMK 107 R+AGIEPASLAWKARGYSRR I +VSNSKPNMK Sbjct: 16 RVAGIEPASLAWKARGYSRRWLIIFDVSNSKPNMK 50 >OEL35491.1 hypothetical protein BAE44_0003490 [Dichanthelium oligosanthes] Length = 51 Score = 55.5 bits (132), Expect = 6e-08 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +3 Query: 3 RIAGIEPASLAWKARGYSRRRFSILNVSNSKPNMK 107 R+ GIEP LAWKARGYS R I NVSNSKPNMK Sbjct: 16 RVVGIEPTLLAWKARGYSGRWLIIFNVSNSKPNMK 50 >OAY33821.1 hypothetical protein MANES_13G128000 [Manihot esculenta] Length = 72 Score = 50.4 bits (119), Expect = 9e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = +3 Query: 261 FNNLSSYFVLYFYLK*S*GKEFCFHRAKT 347 FNN SSYFVLY YL+ S GK FCFHRAKT Sbjct: 9 FNNFSSYFVLYSYLRESLGKAFCFHRAKT 37