BLASTX nr result
ID: Lithospermum23_contig00038032
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00038032 (287 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB64798.1 hypothetical protein B456_010G065500 [Gossypium raimo... 72 2e-14 KJB64799.1 hypothetical protein B456_010G065500 [Gossypium raimo... 72 4e-14 KHG04929.1 Acyl-protein thioesterase 2 [Gossypium arboreum] 70 2e-13 XP_012452249.1 PREDICTED: acyl-protein thioesterase 2-like [Goss... 72 3e-13 XP_016578505.1 PREDICTED: acyl-protein thioesterase 2 [Capsicum ... 72 5e-13 XP_010535874.1 PREDICTED: acyl-protein thioesterase 2-like [Tare... 71 7e-13 KJB83077.1 hypothetical protein B456_013G233000 [Gossypium raimo... 70 1e-12 OMP00144.1 Phospholipase/carboxylesterase/thioesterase [Corchoru... 70 1e-12 KHN08117.1 Acyl-protein thioesterase 2, partial [Glycine soja] 70 1e-12 GAV65988.1 Abhydrolase_2 domain-containing protein [Cephalotus f... 70 1e-12 XP_010249993.1 PREDICTED: acyl-protein thioesterase 2-like [Nelu... 70 1e-12 XP_006465384.1 PREDICTED: acyl-protein thioesterase 2 [Citrus si... 70 1e-12 XP_006427188.1 hypothetical protein CICLE_v10026074mg [Citrus cl... 70 1e-12 XP_002285335.1 PREDICTED: acyl-protein thioesterase 2 [Vitis vin... 70 1e-12 OMO54274.1 Phospholipase/carboxylesterase/thioesterase [Corchoru... 70 1e-12 XP_003526419.1 PREDICTED: acyl-protein thioesterase 2-like [Glyc... 70 1e-12 NP_001240872.1 uncharacterized protein LOC100811642 [Glycine max... 70 1e-12 XP_010254331.1 PREDICTED: acyl-protein thioesterase 2-like [Nelu... 70 1e-12 KHG03780.1 Acyl-protein thioesterase 2 [Gossypium arboreum] 70 2e-12 XP_017642958.1 PREDICTED: acyl-protein thioesterase 2-like isofo... 70 2e-12 >KJB64798.1 hypothetical protein B456_010G065500 [Gossypium raimondii] Length = 122 Score = 72.4 bits (176), Expect = 2e-14 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 179 EFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 EFGRT VVRPKGRHQAT+VWLHDLG++GS WSQLLE Sbjct: 18 EFGRTHVVRPKGRHQATVVWLHDLGDNGSSWSQLLE 53 >KJB64799.1 hypothetical protein B456_010G065500 [Gossypium raimondii] Length = 146 Score = 72.4 bits (176), Expect = 4e-14 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 179 EFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 EFGRT VVRPKGRHQAT+VWLHDLG++GS WSQLLE Sbjct: 18 EFGRTHVVRPKGRHQATVVWLHDLGDNGSSWSQLLE 53 >KHG04929.1 Acyl-protein thioesterase 2 [Gossypium arboreum] Length = 127 Score = 70.1 bits (170), Expect = 2e-13 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 176 VEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 +EFGRT VVRPKGRHQAT+VWLH LG++GS WSQLLE Sbjct: 17 LEFGRTHVVRPKGRHQATVVWLHGLGDNGSSWSQLLE 53 >XP_012452249.1 PREDICTED: acyl-protein thioesterase 2-like [Gossypium raimondii] XP_012452250.1 PREDICTED: acyl-protein thioesterase 2-like [Gossypium raimondii] Length = 253 Score = 72.4 bits (176), Expect = 3e-13 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 179 EFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 EFGRT VVRPKGRHQAT+VWLHDLG++GS WSQLLE Sbjct: 18 EFGRTHVVRPKGRHQATVVWLHDLGDNGSSWSQLLE 53 >XP_016578505.1 PREDICTED: acyl-protein thioesterase 2 [Capsicum annuum] XP_016578506.1 PREDICTED: acyl-protein thioesterase 2 [Capsicum annuum] Length = 256 Score = 71.6 bits (174), Expect = 5e-13 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 TVEFGRT VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 18 TVEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 55 >XP_010535874.1 PREDICTED: acyl-protein thioesterase 2-like [Tarenaya hassleriana] Length = 252 Score = 71.2 bits (173), Expect = 7e-13 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 TVEFG+T VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 17 TVEFGKTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 54 >KJB83077.1 hypothetical protein B456_013G233000 [Gossypium raimondii] Length = 199 Score = 69.7 bits (169), Expect = 1e-12 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 176 VEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 +EFGRT VVRPKGRHQATIVWLH LG++GS WSQLLE Sbjct: 19 LEFGRTYVVRPKGRHQATIVWLHGLGDNGSSWSQLLE 55 >OMP00144.1 Phospholipase/carboxylesterase/thioesterase [Corchorus olitorius] Length = 251 Score = 70.5 bits (171), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 T EFGRT VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 11 TFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 48 >KHN08117.1 Acyl-protein thioesterase 2, partial [Glycine soja] Length = 254 Score = 70.5 bits (171), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 T EFGRT VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 14 TFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 51 >GAV65988.1 Abhydrolase_2 domain-containing protein [Cephalotus follicularis] Length = 257 Score = 70.5 bits (171), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 T EFGRT VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 18 TFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 55 >XP_010249993.1 PREDICTED: acyl-protein thioesterase 2-like [Nelumbo nucifera] XP_010249994.1 PREDICTED: acyl-protein thioesterase 2-like [Nelumbo nucifera] XP_010249995.1 PREDICTED: acyl-protein thioesterase 2-like [Nelumbo nucifera] XP_010249996.1 PREDICTED: acyl-protein thioesterase 2-like [Nelumbo nucifera] XP_019052419.1 PREDICTED: acyl-protein thioesterase 2-like [Nelumbo nucifera] Length = 257 Score = 70.5 bits (171), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 T EFGRT VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 18 TFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 55 >XP_006465384.1 PREDICTED: acyl-protein thioesterase 2 [Citrus sinensis] XP_015385504.1 PREDICTED: acyl-protein thioesterase 2 [Citrus sinensis] KDO52896.1 hypothetical protein CISIN_1g025139mg [Citrus sinensis] KDO52897.1 hypothetical protein CISIN_1g025139mg [Citrus sinensis] KDO52898.1 hypothetical protein CISIN_1g025139mg [Citrus sinensis] KDO52899.1 hypothetical protein CISIN_1g025139mg [Citrus sinensis] Length = 257 Score = 70.5 bits (171), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 T EFGRT VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 18 TFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 55 >XP_006427188.1 hypothetical protein CICLE_v10026074mg [Citrus clementina] XP_006427189.1 hypothetical protein CICLE_v10026074mg [Citrus clementina] ESR40428.1 hypothetical protein CICLE_v10026074mg [Citrus clementina] ESR40429.1 hypothetical protein CICLE_v10026074mg [Citrus clementina] Length = 257 Score = 70.5 bits (171), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 T EFGRT VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 18 TFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 55 >XP_002285335.1 PREDICTED: acyl-protein thioesterase 2 [Vitis vinifera] XP_010654745.1 PREDICTED: acyl-protein thioesterase 2 [Vitis vinifera] Length = 257 Score = 70.5 bits (171), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 T EFGRT VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 18 TFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 55 >OMO54274.1 Phospholipase/carboxylesterase/thioesterase [Corchorus capsularis] Length = 258 Score = 70.5 bits (171), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 T EFGRT VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 18 TFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 55 >XP_003526419.1 PREDICTED: acyl-protein thioesterase 2-like [Glycine max] XP_014631689.1 PREDICTED: acyl-protein thioesterase 2-like [Glycine max] KHN07092.1 Acyl-protein thioesterase 2 [Glycine soja] KRH52469.1 hypothetical protein GLYMA_06G070100 [Glycine max] KRH52470.1 hypothetical protein GLYMA_06G070100 [Glycine max] KRH52471.1 hypothetical protein GLYMA_06G070100 [Glycine max] KRH52472.1 hypothetical protein GLYMA_06G070100 [Glycine max] Length = 258 Score = 70.5 bits (171), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 T EFGRT VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 18 TFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 55 >NP_001240872.1 uncharacterized protein LOC100811642 [Glycine max] XP_006577854.1 PREDICTED: uncharacterized protein LOC100811642 isoform X1 [Glycine max] XP_006577855.1 PREDICTED: uncharacterized protein LOC100811642 isoform X1 [Glycine max] ACU23141.1 unknown [Glycine max] KRH61795.1 hypothetical protein GLYMA_04G068500 [Glycine max] KRH61796.1 hypothetical protein GLYMA_04G068500 [Glycine max] KRH61797.1 hypothetical protein GLYMA_04G068500 [Glycine max] KRH61798.1 hypothetical protein GLYMA_04G068500 [Glycine max] Length = 258 Score = 70.5 bits (171), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 T EFGRT VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 18 TFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 55 >XP_010254331.1 PREDICTED: acyl-protein thioesterase 2-like [Nelumbo nucifera] XP_010254332.1 PREDICTED: acyl-protein thioesterase 2-like [Nelumbo nucifera] Length = 259 Score = 70.5 bits (171), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 T EFGRT VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 20 TFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 57 >KHG03780.1 Acyl-protein thioesterase 2 [Gossypium arboreum] Length = 213 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 176 VEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 +EFGRT VVRPKGRHQATIVWLH LG++GS WSQLLE Sbjct: 19 LEFGRTYVVRPKGRHQATIVWLHGLGDNGSSWSQLLE 55 >XP_017642958.1 PREDICTED: acyl-protein thioesterase 2-like isoform X2 [Gossypium arboreum] Length = 215 Score = 69.7 bits (169), Expect = 2e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 173 TVEFGRTRVVRPKGRHQATIVWLHDLGEDGSRWSQLLE 286 T EFGRT VVRPKG+HQATIVWLH LG++GS WSQLLE Sbjct: 18 TFEFGRTYVVRPKGKHQATIVWLHGLGDNGSSWSQLLE 55