BLASTX nr result
ID: Lithospermum23_contig00037852
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00037852 (310 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011082796.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 9e-06 >XP_011082796.1 PREDICTED: pentatricopeptide repeat-containing protein At5g62370 [Sesamum indicum] XP_011082797.1 PREDICTED: pentatricopeptide repeat-containing protein At5g62370 [Sesamum indicum] XP_011082798.1 PREDICTED: pentatricopeptide repeat-containing protein At5g62370 [Sesamum indicum] Length = 986 Score = 52.8 bits (125), Expect = 9e-06 Identities = 22/45 (48%), Positives = 35/45 (77%) Frame = -2 Query: 309 ICEEMVARDYFPRRYNLKQLVTILRQHNKVPEARALHGLLMKKRS 175 ICE+M++ +YFP RYNL L++IL + NK+ EA A+H L++ +R+ Sbjct: 933 ICEDMLSHNYFPCRYNLHWLISILAKDNKLDEACAIHDLMLNRRT 977