BLASTX nr result
ID: Lithospermum23_contig00037829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00037829 (277 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFO84087.1 hexose transport protein [Actinidia deliciosa] 55 1e-06 >AFO84087.1 hexose transport protein [Actinidia deliciosa] Length = 523 Score = 54.7 bits (130), Expect = 1e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +3 Query: 3 QHWFWSRFMTDVEYTNGGTVEMGKGGDAFKKV 98 QHWFWSRF+TDV+Y G VEMGKGGD K V Sbjct: 492 QHWFWSRFITDVDYPANGAVEMGKGGDNTKYV 523