BLASTX nr result
ID: Lithospermum23_contig00037649
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00037649 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AGW98268.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW97842.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW97822.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW97484.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW98778.1 hypothetical chloroplast RF21 (chloroplast) [Merremia... 55 1e-06 AGW98162.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW98842.1 hypothetical chloroplast RF21 (chloroplast) [Operculi... 55 1e-06 AGW97908.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW97504.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW98183.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW98012.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW99012.1 hypothetical chloroplast RF21 (chloroplast) [Turbina ... 55 1e-06 AGW98502.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW98417.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW97654.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW97059.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW96974.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW97314.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 AGW97079.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ... 55 1e-06 YP_001468351.1 hypothetical chloroplast RF21 [Ipomoea purpurea] ... 55 1e-06 >AGW98268.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea tricolor] Length = 2078 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1512 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1562 >AGW97842.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea pes-caprae] Length = 2101 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1535 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1585 >AGW97822.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea pes-caprae] Length = 2162 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1611 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1661 >AGW97484.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea murucoides] Length = 2175 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1616 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1666 >AGW98778.1 hypothetical chloroplast RF21 (chloroplast) [Merremia quinquefolia] Length = 2188 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1637 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1687 >AGW98162.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ternifolia] Length = 2188 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1632 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1682 >AGW98842.1 hypothetical chloroplast RF21 (chloroplast) [Operculina macrocarpa] AGW98862.1 hypothetical chloroplast RF21 (chloroplast) [Operculina macrocarpa] Length = 2189 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1627 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1677 >AGW97908.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea polpha] Length = 2189 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1630 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1680 >AGW97504.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea murucoides] Length = 2189 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1630 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1680 >AGW98183.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea ternifolia] Length = 2193 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1632 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1682 >AGW98012.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea setosa] Length = 2194 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1635 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1685 >AGW99012.1 hypothetical chloroplast RF21 (chloroplast) [Turbina corymbosa] AGW99033.1 hypothetical chloroplast RF21 (chloroplast) [Turbina corymbosa] Length = 2196 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1630 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1680 >AGW98502.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea minutiflora] AGW98523.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea minutiflora] Length = 2196 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1630 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1680 >AGW98417.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea cordatotriloba] Length = 2196 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1630 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1680 >AGW97654.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea orizabensis] AGW97674.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea orizabensis] Length = 2196 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1630 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1680 >AGW97059.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea diamantinensis] Length = 2196 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1630 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1680 >AGW96974.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea cairica] AGW96994.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea cairica] Length = 2196 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1630 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1680 >AGW97314.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea hederifolia] AGW97334.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea hederifolia] Length = 2197 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1631 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1681 >AGW97079.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea diamantinensis] Length = 2197 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1635 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1685 >YP_001468351.1 hypothetical chloroplast RF21 [Ipomoea purpurea] YP_001468373.1 hypothetical chloroplast RF21 [Ipomoea purpurea] A7Y3J6.1 RecName: Full=Protein Ycf2 ABV02391.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea purpurea] ABV02414.1 hypothetical chloroplast RF21 (chloroplast) [Ipomoea purpurea] Length = 2197 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 285 LAYHLEFLIVRSM-PTICISSGMDYKHHDLGVNESNYLSLGLLVNHLSSDCGRCS 124 L+ L+F + R+M P I + HDL VNESNYLSLGLLVNHLS DC RCS Sbjct: 1631 LSITLQFELARAMSPCIIWIPNI----HDLDVNESNYLSLGLLVNHLSRDCERCS 1681