BLASTX nr result
ID: Lithospermum23_contig00037487
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00037487 (447 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV13816.1 short-chain dehydrogenase TIC 32, chloroplastic [Dorc... 56 1e-06 KZV53390.1 short-chain dehydrogenase TIC 32, chloroplastic [Dorc... 56 2e-06 XP_018512564.1 PREDICTED: short-chain dehydrogenase TIC 32, chlo... 55 4e-06 XP_018512563.1 PREDICTED: short-chain dehydrogenase TIC 32, chlo... 55 4e-06 XP_018512562.1 PREDICTED: short-chain dehydrogenase TIC 32, chlo... 55 5e-06 XP_006381188.1 hypothetical protein POPTR_0006s08410g [Populus t... 54 7e-06 >KZV13816.1 short-chain dehydrogenase TIC 32, chloroplastic [Dorcoceras hygrometricum] KZV53389.1 short-chain dehydrogenase TIC 32, chloroplastic [Dorcoceras hygrometricum] Length = 216 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 447 QAEGTNITVNSVHPGLIMTNLFKHTGNLM 361 QAEG N+TVNSVHPGLIMTNLFKH+G LM Sbjct: 111 QAEGANVTVNSVHPGLIMTNLFKHSGFLM 139 >KZV53390.1 short-chain dehydrogenase TIC 32, chloroplastic [Dorcoceras hygrometricum] Length = 295 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 447 QAEGTNITVNSVHPGLIMTNLFKHTGNLM 361 QAEG N+TVNSVHPGLIMTNLFKH+G LM Sbjct: 190 QAEGANVTVNSVHPGLIMTNLFKHSGFLM 218 >XP_018512564.1 PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like isoform X4 [Brassica rapa] Length = 279 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -1 Query: 447 QAEGTNITVNSVHPGLIMTNLFKHTGNLMGKYRL 346 Q EG NITVNSVHPGLI+TNLF+HT LM K+ L Sbjct: 143 QEEGVNITVNSVHPGLILTNLFQHTALLMSKFSL 176 >XP_018512563.1 PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like isoform X3 [Brassica rapa] Length = 295 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -1 Query: 447 QAEGTNITVNSVHPGLIMTNLFKHTGNLMGKYRL 346 Q EG NITVNSVHPGLI+TNLF+HT LM K+ L Sbjct: 221 QEEGVNITVNSVHPGLILTNLFQHTALLMSKFSL 254 >XP_018512562.1 PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like isoform X1 [Brassica rapa] Length = 357 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -1 Query: 447 QAEGTNITVNSVHPGLIMTNLFKHTGNLMGKYRL 346 Q EG NITVNSVHPGLI+TNLF+HT LM K+ L Sbjct: 221 QEEGVNITVNSVHPGLILTNLFQHTALLMSKFSL 254 >XP_006381188.1 hypothetical protein POPTR_0006s08410g [Populus trichocarpa] ERP58985.1 hypothetical protein POPTR_0006s08410g [Populus trichocarpa] Length = 271 Score = 54.3 bits (129), Expect = 7e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 447 QAEGTNITVNSVHPGLIMTNLFKHTGNLMGKYRL 346 Q EG NIT N+VHPGLIMTNLFKH+ LM KY L Sbjct: 221 QEEGVNITANAVHPGLIMTNLFKHSAILMSKYVL 254