BLASTX nr result
ID: Lithospermum23_contig00037393
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00037393 (211 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011086573.1 PREDICTED: uncharacterized protein LOC105168262 [... 58 3e-08 XP_016511948.1 PREDICTED: uncharacterized protein LOC107829043 [... 57 4e-08 KZV24427.1 hypothetical protein F511_24222 [Dorcoceras hygrometr... 57 4e-08 XP_019264122.1 PREDICTED: histone H3.v1-like [Nicotiana attenuat... 57 6e-08 XP_018632095.1 PREDICTED: uncharacterized protein DDB_G0286299 i... 57 6e-08 XP_009765758.1 PREDICTED: DNA ligase 1-like [Nicotiana sylvestris] 57 6e-08 XP_016457483.1 PREDICTED: DNA ligase 1-like [Nicotiana tabacum] 57 6e-08 XP_018632094.1 PREDICTED: histone H3.v1 isoform X2 [Nicotiana to... 57 6e-08 XP_009621069.2 PREDICTED: histone H3.v1 isoform X1 [Nicotiana to... 57 6e-08 XP_019163548.1 PREDICTED: uncharacterized protein LOC109159894 [... 56 1e-07 XP_015076863.1 PREDICTED: uncharacterized protein LOC107020858 [... 56 2e-07 XP_004238656.1 PREDICTED: uncharacterized protein LOC101248673 [... 56 2e-07 XP_015168326.1 PREDICTED: uncharacterized protein LOC107062317 [... 56 2e-07 XP_011071089.1 PREDICTED: uncharacterized protein LOC105156609 [... 55 3e-07 XP_019263934.1 PREDICTED: uncharacterized protein LOC109241637 [... 54 6e-07 XP_009623535.1 PREDICTED: uncharacterized protein LOC104114726 [... 54 6e-07 KZV17820.1 hypothetical protein F511_01629 [Dorcoceras hygrometr... 54 7e-07 KZT76469.1 hypothetical protein F511_46506, partial [Dorcoceras ... 53 1e-06 XP_012844785.1 PREDICTED: uncharacterized protein LOC105964827 [... 54 1e-06 XP_016494663.1 PREDICTED: uncharacterized protein LOC107813864 [... 53 2e-06 >XP_011086573.1 PREDICTED: uncharacterized protein LOC105168262 [Sesamum indicum] Length = 274 Score = 57.8 bits (138), Expect = 3e-08 Identities = 33/80 (41%), Positives = 39/80 (48%), Gaps = 10/80 (12%) Frame = -2 Query: 210 AFVFLNNHH----------QTTSNHQXXXXXXXXXXXXXXXXXXXXXTVSAHEAYLKNKA 61 AFVFLNN H T + VSAHEAYL++KA Sbjct: 181 AFVFLNNAHAPPPPSAAEQSTKGDEMGERTKVKEKAKKGGKGKTAAVRVSAHEAYLRSKA 240 Query: 60 KENDRRKSYLPYRPEVFGFF 1 K +RR+SYLPYRPE+ GFF Sbjct: 241 KGEERRRSYLPYRPELMGFF 260 >XP_016511948.1 PREDICTED: uncharacterized protein LOC107829043 [Nicotiana tabacum] Length = 212 Score = 57.0 bits (136), Expect = 4e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 V AHEAY+K+KAK+ DRR+SYLPYRPE+ GFF Sbjct: 167 VLAHEAYMKSKAKDEDRRRSYLPYRPELVGFF 198 >KZV24427.1 hypothetical protein F511_24222 [Dorcoceras hygrometricum] Length = 267 Score = 57.4 bits (137), Expect = 4e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 VSAH YLKNKAK+ DRR++YLPYRPE+ GFF Sbjct: 222 VSAHAVYLKNKAKQEDRRRTYLPYRPELMGFF 253 >XP_019264122.1 PREDICTED: histone H3.v1-like [Nicotiana attenuata] OIT36648.1 hypothetical protein A4A49_10956 [Nicotiana attenuata] Length = 276 Score = 57.0 bits (136), Expect = 6e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 V AHEAY+K+KAK+ DRR+SYLPYRPE+ GFF Sbjct: 231 VLAHEAYMKSKAKDEDRRRSYLPYRPELVGFF 262 >XP_018632095.1 PREDICTED: uncharacterized protein DDB_G0286299 isoform X3 [Nicotiana tomentosiformis] Length = 278 Score = 57.0 bits (136), Expect = 6e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 V AHEAY+K+KAK+ DRR+SYLPYRPE+ GFF Sbjct: 233 VLAHEAYMKSKAKDEDRRRSYLPYRPELVGFF 264 >XP_009765758.1 PREDICTED: DNA ligase 1-like [Nicotiana sylvestris] Length = 280 Score = 57.0 bits (136), Expect = 6e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 V AHEAY+K+KAK+ DRR+SYLPYRPE+ GFF Sbjct: 235 VLAHEAYMKSKAKDEDRRRSYLPYRPELVGFF 266 >XP_016457483.1 PREDICTED: DNA ligase 1-like [Nicotiana tabacum] Length = 281 Score = 57.0 bits (136), Expect = 6e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 V AHEAY+K+KAK+ DRR+SYLPYRPE+ GFF Sbjct: 236 VLAHEAYMKSKAKDEDRRRSYLPYRPELVGFF 267 >XP_018632094.1 PREDICTED: histone H3.v1 isoform X2 [Nicotiana tomentosiformis] Length = 283 Score = 57.0 bits (136), Expect = 6e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 V AHEAY+K+KAK+ DRR+SYLPYRPE+ GFF Sbjct: 238 VLAHEAYMKSKAKDEDRRRSYLPYRPELVGFF 269 >XP_009621069.2 PREDICTED: histone H3.v1 isoform X1 [Nicotiana tomentosiformis] Length = 287 Score = 57.0 bits (136), Expect = 6e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 V AHEAY+K+KAK+ DRR+SYLPYRPE+ GFF Sbjct: 242 VLAHEAYMKSKAKDEDRRRSYLPYRPELVGFF 273 >XP_019163548.1 PREDICTED: uncharacterized protein LOC109159894 [Ipomoea nil] Length = 275 Score = 56.2 bits (134), Expect = 1e-07 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 +SAHE Y+K+KAK+ DRR+SYLPYRPE+ GFF Sbjct: 230 LSAHERYMKSKAKDEDRRRSYLPYRPELVGFF 261 >XP_015076863.1 PREDICTED: uncharacterized protein LOC107020858 [Solanum pennellii] Length = 283 Score = 55.8 bits (133), Expect = 2e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 V AHEAY+K+KAK DRR+SYLPYRPE+ GFF Sbjct: 238 VLAHEAYMKSKAKAEDRRRSYLPYRPELVGFF 269 >XP_004238656.1 PREDICTED: uncharacterized protein LOC101248673 [Solanum lycopersicum] Length = 283 Score = 55.8 bits (133), Expect = 2e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 V AHEAY+K+KAK DRR+SYLPYRPE+ GFF Sbjct: 238 VLAHEAYMKSKAKAEDRRRSYLPYRPELVGFF 269 >XP_015168326.1 PREDICTED: uncharacterized protein LOC107062317 [Solanum tuberosum] Length = 284 Score = 55.8 bits (133), Expect = 2e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 V AHEAY+K+KAK DRR+SYLPYRPE+ GFF Sbjct: 239 VLAHEAYMKSKAKAEDRRRSYLPYRPELVGFF 270 >XP_011071089.1 PREDICTED: uncharacterized protein LOC105156609 [Sesamum indicum] Length = 287 Score = 55.1 bits (131), Expect = 3e-07 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 +SAHE YL++KAKE +RR++YLPYRPE+ GFF Sbjct: 242 LSAHEVYLRSKAKEEERRRAYLPYRPELMGFF 273 >XP_019263934.1 PREDICTED: uncharacterized protein LOC109241637 [Nicotiana attenuata] OIT36782.1 hypothetical protein A4A49_27124 [Nicotiana attenuata] Length = 295 Score = 54.3 bits (129), Expect = 6e-07 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 V AHEAY+K+KA++ +RR+SYLPYRPE+ GFF Sbjct: 250 VLAHEAYMKSKARDEERRRSYLPYRPELVGFF 281 >XP_009623535.1 PREDICTED: uncharacterized protein LOC104114726 [Nicotiana tomentosiformis] XP_016501119.1 PREDICTED: uncharacterized protein LOC107819520 [Nicotiana tabacum] Length = 296 Score = 54.3 bits (129), Expect = 6e-07 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 V AHEAY+K+KA++ +RR+SYLPYRPE+ GFF Sbjct: 251 VLAHEAYMKSKARDEERRRSYLPYRPELVGFF 282 >KZV17820.1 hypothetical protein F511_01629 [Dorcoceras hygrometricum] Length = 247 Score = 53.9 bits (128), Expect = 7e-07 Identities = 21/32 (65%), Positives = 29/32 (90%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 +SAHE YL++KAK+ ++R+SYLPYRPE+ GFF Sbjct: 202 LSAHEVYLRSKAKDGEKRRSYLPYRPELMGFF 233 >KZT76469.1 hypothetical protein F511_46506, partial [Dorcoceras hygrometricum] Length = 178 Score = 52.8 bits (125), Expect = 1e-06 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 +S+HE YLK+KAK+ +R+SYLPYRPE+ GFF Sbjct: 133 LSSHEVYLKSKAKDEGKRRSYLPYRPELMGFF 164 >XP_012844785.1 PREDICTED: uncharacterized protein LOC105964827 [Erythranthe guttata] EYU31251.1 hypothetical protein MIMGU_mgv1a011075mg [Erythranthe guttata] Length = 293 Score = 53.5 bits (127), Expect = 1e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 +SAHE YL++KAK +RR+SYLPYRPE+ GFF Sbjct: 248 LSAHEVYLRSKAKGEERRRSYLPYRPELMGFF 279 >XP_016494663.1 PREDICTED: uncharacterized protein LOC107813864 [Nicotiana tabacum] Length = 291 Score = 53.1 bits (126), Expect = 2e-06 Identities = 21/32 (65%), Positives = 29/32 (90%) Frame = -2 Query: 96 VSAHEAYLKNKAKENDRRKSYLPYRPEVFGFF 1 V AHEAY+++KA++ +RR+SYLPYRPE+ GFF Sbjct: 246 VLAHEAYMRSKARDEERRRSYLPYRPELVGFF 277