BLASTX nr result
ID: Lithospermum23_contig00037272
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00037272 (186 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004294580.1 PREDICTED: uncharacterized protein LOC101295786 [... 57 4e-08 XP_009353715.1 PREDICTED: uncharacterized protein LOC103944953 [... 55 5e-08 OMO67707.1 hypothetical protein CCACVL1_20367 [Corchorus capsula... 57 5e-08 OMO91300.1 Histone H4 [Corchorus olitorius] 57 5e-08 XP_017249940.1 PREDICTED: uncharacterized protein LOC108220639 [... 56 6e-08 XP_008223182.1 PREDICTED: uncharacterized protein LOC103323003 i... 55 6e-08 XP_007205447.1 hypothetical protein PRUPE_ppa007858mg [Prunus pe... 55 6e-08 XP_007205446.1 hypothetical protein PRUPE_ppa007858mg [Prunus pe... 55 6e-08 XP_007205448.1 hypothetical protein PRUPE_ppa007858mg [Prunus pe... 55 6e-08 XP_011657896.1 PREDICTED: uncharacterized protein LOC101221721 i... 57 7e-08 XP_008457547.1 PREDICTED: uncharacterized protein LOC103497213 i... 57 7e-08 KJB20146.1 hypothetical protein B456_003G135100 [Gossypium raimo... 57 7e-08 XP_008457546.1 PREDICTED: uncharacterized protein LOC103497213 i... 57 7e-08 XP_004149041.1 PREDICTED: uncharacterized protein LOC101221721 i... 57 7e-08 XP_003539689.1 PREDICTED: uncharacterized protein LOC100775283 [... 57 7e-08 XP_016665186.1 PREDICTED: uncharacterized protein LOC107885931 i... 57 7e-08 XP_016740569.1 PREDICTED: uncharacterized protein LOC107950270 i... 57 7e-08 XP_016665185.1 PREDICTED: uncharacterized protein LOC107885931 i... 57 7e-08 KJB20147.1 hypothetical protein B456_003G135100 [Gossypium raimo... 57 7e-08 XP_012471386.1 PREDICTED: uncharacterized protein LOC105788866 [... 57 7e-08 >XP_004294580.1 PREDICTED: uncharacterized protein LOC101295786 [Fragaria vesca subsp. vesca] Length = 357 Score = 57.0 bits (136), Expect(2) = 4e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 I +L G+ELRMATSTRLKTCLYSFTSPGGP Sbjct: 252 IKVLQGMELRMATSTRLKTCLYSFTSPGGP 281 Score = 27.7 bits (60), Expect(2) = 4e-08 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 Query: 1 LLHYLSHLKILQG 39 LLHY SH+K+LQG Sbjct: 245 LLHYFSHIKVLQG 257 >XP_009353715.1 PREDICTED: uncharacterized protein LOC103944953 [Pyrus x bretschneideri] Length = 357 Score = 55.1 bits (131), Expect(2) = 5e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 I +L G+ELRMATSTRLK CLYSFTSPGGP Sbjct: 252 IKVLQGMELRMATSTRLKACLYSFTSPGGP 281 Score = 29.3 bits (64), Expect(2) = 5e-08 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 1 LLHYLSHLKILQG 39 LLHYLSH+K+LQG Sbjct: 245 LLHYLSHIKVLQG 257 >OMO67707.1 hypothetical protein CCACVL1_20367 [Corchorus capsularis] Length = 687 Score = 57.0 bits (136), Expect = 5e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 I +L G+ELRMATSTRLKTCLYSFTSPGGP Sbjct: 623 IKVLQGMELRMATSTRLKTCLYSFTSPGGP 652 >OMO91300.1 Histone H4 [Corchorus olitorius] Length = 918 Score = 57.0 bits (136), Expect = 5e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 I +L G+ELRMATSTRLKTCLYSFTSPGGP Sbjct: 812 IKVLQGMELRMATSTRLKTCLYSFTSPGGP 841 >XP_017249940.1 PREDICTED: uncharacterized protein LOC108220639 [Daucus carota subsp. sativus] KZM95653.1 hypothetical protein DCAR_018895 [Daucus carota subsp. sativus] Length = 357 Score = 56.2 bits (134), Expect(2) = 6e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 I L G+ELRMATSTRLKTCLYSFTSPGGP Sbjct: 251 IKALQGMELRMATSTRLKTCLYSFTSPGGP 280 Score = 27.7 bits (60), Expect(2) = 6e-08 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 1 LLHYLSHLKILQG 39 LLHYLSH+K LQG Sbjct: 244 LLHYLSHIKALQG 256 >XP_008223182.1 PREDICTED: uncharacterized protein LOC103323003 isoform X1 [Prunus mume] Length = 353 Score = 55.1 bits (131), Expect(2) = 6e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 I LL G++LRMATSTRLK CLYSFTSPGGP Sbjct: 248 IKLLQGMDLRMATSTRLKACLYSFTSPGGP 277 Score = 28.9 bits (63), Expect(2) = 6e-08 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 1 LLHYLSHLKILQG 39 LLHYLSH+K+LQG Sbjct: 241 LLHYLSHIKLLQG 253 >XP_007205447.1 hypothetical protein PRUPE_ppa007858mg [Prunus persica] ONI00307.1 hypothetical protein PRUPE_6G081500 [Prunus persica] Length = 353 Score = 55.1 bits (131), Expect(2) = 6e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 I LL G++LRMATSTRLK CLYSFTSPGGP Sbjct: 248 IKLLQGMDLRMATSTRLKACLYSFTSPGGP 277 Score = 28.9 bits (63), Expect(2) = 6e-08 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 1 LLHYLSHLKILQG 39 LLHYLSH+K+LQG Sbjct: 241 LLHYLSHIKLLQG 253 >XP_007205446.1 hypothetical protein PRUPE_ppa007858mg [Prunus persica] XP_008223190.1 PREDICTED: uncharacterized protein LOC103323003 isoform X2 [Prunus mume] ONI00308.1 hypothetical protein PRUPE_6G081500 [Prunus persica] Length = 321 Score = 55.1 bits (131), Expect(2) = 6e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 I LL G++LRMATSTRLK CLYSFTSPGGP Sbjct: 216 IKLLQGMDLRMATSTRLKACLYSFTSPGGP 245 Score = 28.9 bits (63), Expect(2) = 6e-08 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 1 LLHYLSHLKILQG 39 LLHYLSH+K+LQG Sbjct: 209 LLHYLSHIKLLQG 221 >XP_007205448.1 hypothetical protein PRUPE_ppa007858mg [Prunus persica] ONI00309.1 hypothetical protein PRUPE_6G081500 [Prunus persica] Length = 226 Score = 55.1 bits (131), Expect(2) = 6e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 I LL G++LRMATSTRLK CLYSFTSPGGP Sbjct: 121 IKLLQGMDLRMATSTRLKACLYSFTSPGGP 150 Score = 28.9 bits (63), Expect(2) = 6e-08 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 1 LLHYLSHLKILQG 39 LLHYLSH+K+LQG Sbjct: 114 LLHYLSHIKLLQG 126 >XP_011657896.1 PREDICTED: uncharacterized protein LOC101221721 isoform X2 [Cucumis sativus] Length = 312 Score = 56.6 bits (135), Expect = 7e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 +++L G+ELRM TSTRLKTCLYSFTSPGGP Sbjct: 206 LIVLQGMELRMTTSTRLKTCLYSFTSPGGP 235 >XP_008457547.1 PREDICTED: uncharacterized protein LOC103497213 isoform X2 [Cucumis melo] XP_008457548.1 PREDICTED: uncharacterized protein LOC103497213 isoform X2 [Cucumis melo] Length = 312 Score = 56.6 bits (135), Expect = 7e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 +++L G+ELRM TSTRLKTCLYSFTSPGGP Sbjct: 206 LIVLQGMELRMTTSTRLKTCLYSFTSPGGP 235 >KJB20146.1 hypothetical protein B456_003G135100 [Gossypium raimondii] Length = 344 Score = 56.6 bits (135), Expect = 7e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 + +L G+ELRMATSTRLKTCLYSFTSPGGP Sbjct: 238 VKILRGMELRMATSTRLKTCLYSFTSPGGP 267 >XP_008457546.1 PREDICTED: uncharacterized protein LOC103497213 isoform X1 [Cucumis melo] Length = 358 Score = 56.6 bits (135), Expect = 7e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 +++L G+ELRM TSTRLKTCLYSFTSPGGP Sbjct: 252 LIVLQGMELRMTTSTRLKTCLYSFTSPGGP 281 >XP_004149041.1 PREDICTED: uncharacterized protein LOC101221721 isoform X1 [Cucumis sativus] KGN65666.1 hypothetical protein Csa_1G480700 [Cucumis sativus] Length = 358 Score = 56.6 bits (135), Expect = 7e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 +++L G+ELRM TSTRLKTCLYSFTSPGGP Sbjct: 252 LIVLQGMELRMTTSTRLKTCLYSFTSPGGP 281 >XP_003539689.1 PREDICTED: uncharacterized protein LOC100775283 [Glycine max] KRH24826.1 hypothetical protein GLYMA_12G064800 [Glycine max] Length = 358 Score = 56.6 bits (135), Expect = 7e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 I +L GLELRM TSTRLKTCLYSFTSPGGP Sbjct: 252 IKILQGLELRMTTSTRLKTCLYSFTSPGGP 281 >XP_016665186.1 PREDICTED: uncharacterized protein LOC107885931 isoform X2 [Gossypium hirsutum] Length = 359 Score = 56.6 bits (135), Expect = 7e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 + +L G+ELRMATSTRLKTCLYSFTSPGGP Sbjct: 253 VKILRGMELRMATSTRLKTCLYSFTSPGGP 282 >XP_016740569.1 PREDICTED: uncharacterized protein LOC107950270 isoform X2 [Gossypium hirsutum] Length = 360 Score = 56.6 bits (135), Expect = 7e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 + +L G+ELRMATSTRLKTCLYSFTSPGGP Sbjct: 254 VKILRGMELRMATSTRLKTCLYSFTSPGGP 283 >XP_016665185.1 PREDICTED: uncharacterized protein LOC107885931 isoform X1 [Gossypium hirsutum] Length = 360 Score = 56.6 bits (135), Expect = 7e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 + +L G+ELRMATSTRLKTCLYSFTSPGGP Sbjct: 254 VKILRGMELRMATSTRLKTCLYSFTSPGGP 283 >KJB20147.1 hypothetical protein B456_003G135100 [Gossypium raimondii] Length = 360 Score = 56.6 bits (135), Expect = 7e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 + +L G+ELRMATSTRLKTCLYSFTSPGGP Sbjct: 254 VKILRGMELRMATSTRLKTCLYSFTSPGGP 283 >XP_012471386.1 PREDICTED: uncharacterized protein LOC105788866 [Gossypium raimondii] KJB20145.1 hypothetical protein B456_003G135100 [Gossypium raimondii] Length = 360 Score = 56.6 bits (135), Expect = 7e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 95 IVLLSGLELRMATSTRLKTCLYSFTSPGGP 184 + +L G+ELRMATSTRLKTCLYSFTSPGGP Sbjct: 254 VKILRGMELRMATSTRLKTCLYSFTSPGGP 283