BLASTX nr result
ID: Lithospermum23_contig00037020
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00037020 (581 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016490726.1 PREDICTED: putative pentatricopeptide repeat-cont... 63 9e-09 OMO83876.1 hypothetical protein CCACVL1_11118 [Corchorus capsula... 64 1e-08 OMO61017.1 hypothetical protein COLO4_33609 [Corchorus olitorius] 64 1e-08 XP_009593769.1 PREDICTED: putative pentatricopeptide repeat-cont... 63 2e-08 XP_009790968.1 PREDICTED: putative pentatricopeptide repeat-cont... 62 8e-08 XP_019172764.1 PREDICTED: putative pentatricopeptide repeat-cont... 62 8e-08 XP_018625951.1 PREDICTED: putative pentatricopeptide repeat-cont... 61 1e-07 XP_009766478.1 PREDICTED: putative pentatricopeptide repeat-cont... 61 1e-07 XP_019262118.1 PREDICTED: putative pentatricopeptide repeat-cont... 61 1e-07 XP_019227031.1 PREDICTED: putative pentatricopeptide repeat-cont... 61 1e-07 XP_009766475.1 PREDICTED: putative pentatricopeptide repeat-cont... 61 1e-07 XP_016503752.1 PREDICTED: putative pentatricopeptide repeat-cont... 61 1e-07 XP_008228937.1 PREDICTED: putative pentatricopeptide repeat-cont... 60 3e-07 XP_010932326.1 PREDICTED: putative pentatricopeptide repeat-cont... 60 3e-07 XP_018857088.1 PREDICTED: putative pentatricopeptide repeat-cont... 59 5e-07 EOX92886.1 Pentatricopeptide repeat superfamily protein, putativ... 59 5e-07 EOX92888.1 Pentatricopeptide repeat superfamily protein, putativ... 59 5e-07 EOX92885.1 Pentatricopeptide repeat superfamily protein, putativ... 59 5e-07 XP_007215356.1 hypothetical protein PRUPE_ppa005519mg [Prunus pe... 59 7e-07 ONI16672.1 hypothetical protein PRUPE_3G114500 [Prunus persica] ... 59 7e-07 >XP_016490726.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tabacum] Length = 234 Score = 63.2 bits (152), Expect = 9e-09 Identities = 30/59 (50%), Positives = 41/59 (69%) Frame = -3 Query: 579 GLCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 GLC+ GRFR ASKLLL CV GM IL ++KR +++ SSGF E + +SK+R+ I+ Sbjct: 174 GLCKAGRFRAASKLLLSCVRGGMRILKSNKRVVITGLRSSGFSHEARKVQSKIRLAKIL 232 >OMO83876.1 hypothetical protein CCACVL1_11118 [Corchorus capsularis] Length = 462 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/58 (51%), Positives = 42/58 (72%) Frame = -3 Query: 576 LCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 LCR+G++R ASKLLL C+ GM IL + +RA+LS H SGF+ E K +SK+R+ I+ Sbjct: 403 LCRIGKYRKASKLLLSCLRSGMNILKSAQRAVLSGLHYSGFRGEAKKLKSKIRMARIL 460 >OMO61017.1 hypothetical protein COLO4_33609 [Corchorus olitorius] Length = 462 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/58 (51%), Positives = 42/58 (72%) Frame = -3 Query: 576 LCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 LCR+G++R ASKLLL C+ GM IL + +RA+LS H SGF+ E K +SK+R+ I+ Sbjct: 403 LCRIGKYRKASKLLLSCLRSGMNILKSAQRAVLSGLHYSGFRGEAKKLKSKIRMARIL 460 >XP_009593769.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] XP_018624367.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] XP_018624368.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] XP_018624369.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] XP_018624370.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tomentosiformis] Length = 460 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/59 (50%), Positives = 41/59 (69%) Frame = -3 Query: 579 GLCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 GLC+ GRFR ASKLLL CV GM IL ++KR +++ SSGF E + +SK+R+ I+ Sbjct: 400 GLCKAGRFRAASKLLLSCVRGGMRILKSNKRVVITGLRSSGFSHEARKVQSKIRLAKIL 458 >XP_009790968.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana sylvestris] XP_009790969.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana sylvestris] XP_009790970.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana sylvestris] XP_009790971.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana sylvestris] XP_009790973.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana sylvestris] XP_016462642.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tabacum] XP_016462648.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tabacum] XP_016462653.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tabacum] XP_016462661.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tabacum] Length = 460 Score = 61.6 bits (148), Expect = 8e-08 Identities = 30/59 (50%), Positives = 40/59 (67%) Frame = -3 Query: 579 GLCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 GLC+ GRF ASKLLL CV GM IL ++KR ++S SSGF E + +SK+R+ I+ Sbjct: 400 GLCKAGRFCAASKLLLSCVRDGMRILKSNKRVVISGLRSSGFSHEARKVQSKIRLAKIL 458 >XP_019172764.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Ipomoea nil] Length = 461 Score = 61.6 bits (148), Expect = 8e-08 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = -3 Query: 579 GLCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRV 415 GLCR GRFR ASKLLL C+ GM IL +DK A++ SGF E + +S++RV Sbjct: 400 GLCRTGRFREASKLLLSCIRGGMKILKSDKEAVIDGLRRSGFLLEARKLQSRIRV 454 >XP_018625951.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X2 [Nicotiana tomentosiformis] Length = 390 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/59 (49%), Positives = 39/59 (66%) Frame = -3 Query: 579 GLCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 GLC+ GRFR ASKLLL C+ GM IL +DKR ++ SSG E + +SK+R+ I+ Sbjct: 330 GLCKAGRFRAASKLLLSCIRGGMRILKSDKRFVVDGLRSSGLSQEARKVQSKIRLAKIL 388 >XP_009766478.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X2 [Nicotiana sylvestris] Length = 390 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/59 (49%), Positives = 39/59 (66%) Frame = -3 Query: 579 GLCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 GLC+ GRFR ASKLLL C+ GM IL +DKR ++ SSG E + +SK+R+ I+ Sbjct: 330 GLCKAGRFRAASKLLLSCIRGGMRILKSDKRFVVDGLRSSGLSQEARKVQSKIRLAKIL 388 >XP_019262118.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana attenuata] OIT38052.1 putative pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 460 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/59 (49%), Positives = 39/59 (66%) Frame = -3 Query: 579 GLCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 GLC+ GRFR ASKLLL C+ GM IL +DKR ++ SSG E + +SK+R+ I+ Sbjct: 400 GLCKAGRFRAASKLLLSCIRGGMRILKSDKRFVVDGLRSSGLSQEARKVQSKIRLAKIL 458 >XP_019227031.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana attenuata] XP_019227032.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana attenuata] XP_019227034.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana attenuata] XP_019227035.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana attenuata] XP_019227036.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana attenuata] OIT31662.1 putative pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 460 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/59 (50%), Positives = 40/59 (67%) Frame = -3 Query: 579 GLCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 GLC+ GRFR ASKLLL CV GM IL ++K ++S SSGF E + +SK+R+ I+ Sbjct: 400 GLCKAGRFRAASKLLLSCVRGGMRILKSNKCVVISGLRSSGFSHEARKVQSKIRLAKIL 458 >XP_009766475.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Nicotiana sylvestris] XP_009766476.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Nicotiana sylvestris] XP_009766477.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Nicotiana sylvestris] XP_016498619.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tabacum] XP_016498620.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tabacum] XP_016498621.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tabacum] XP_016498622.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tabacum] Length = 460 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/59 (49%), Positives = 39/59 (66%) Frame = -3 Query: 579 GLCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 GLC+ GRFR ASKLLL C+ GM IL +DKR ++ SSG E + +SK+R+ I+ Sbjct: 400 GLCKAGRFRAASKLLLSCIRGGMRILKSDKRFVVDGLRSSGLSQEARKVQSKIRLAKIL 458 >XP_016503752.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Nicotiana tabacum] XP_018625948.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Nicotiana tomentosiformis] Length = 460 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/59 (49%), Positives = 39/59 (66%) Frame = -3 Query: 579 GLCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 GLC+ GRFR ASKLLL C+ GM IL +DKR ++ SSG E + +SK+R+ I+ Sbjct: 400 GLCKAGRFRAASKLLLSCIRGGMRILKSDKRFVVDGLRSSGLSQEARKVQSKIRLAKIL 458 >XP_008228937.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Prunus mume] XP_016648849.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Prunus mume] XP_016648850.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Prunus mume] XP_016648851.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Prunus mume] Length = 457 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/58 (50%), Positives = 39/58 (67%) Frame = -3 Query: 576 LCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 LCR GRFR ASKL++KC+ G IL A KRA+L+ SSG+ E K + K++V I+ Sbjct: 399 LCRAGRFRCASKLMMKCLKDGKKILRATKRAVLAGLRSSGYTDEAKKLQWKIQVARIL 456 >XP_010932326.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Elaeis guineensis] Length = 462 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/55 (50%), Positives = 39/55 (70%) Frame = -3 Query: 579 GLCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRV 415 GLCR GRFR+ASKLLL C+ GM +L + +RA+++ SSGFK + R+ LR+ Sbjct: 402 GLCRKGRFRVASKLLLTCLREGMNVLRSAQRAVITGLQSSGFKRDAGKLRTALRL 456 >XP_018857088.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Juglans regia] XP_018857094.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Juglans regia] XP_018857100.1 PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Juglans regia] Length = 456 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = -3 Query: 576 LCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRV 415 LC+ GRFR ASKLLL C+ GM IL + +RA+L SGF SE + RSKL++ Sbjct: 398 LCKAGRFRCASKLLLTCIKGGMKILKSTQRAVLDGLCYSGFTSEARKLRSKLQL 451 >EOX92886.1 Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] EOX92887.1 Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] Length = 457 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/58 (50%), Positives = 39/58 (67%) Frame = -3 Query: 576 LCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 LCR GR+R ASKLLL C+ GM IL + +RA+LS SGF E + +SK+R+ I+ Sbjct: 398 LCRAGRYRSASKLLLSCLRSGMKILKSAQRAVLSGLRYSGFPGEARKVQSKIRIARIL 455 >EOX92888.1 Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] EOX92889.1 Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] Length = 490 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/58 (50%), Positives = 39/58 (67%) Frame = -3 Query: 576 LCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 LCR GR+R ASKLLL C+ GM IL + +RA+LS SGF E + +SK+R+ I+ Sbjct: 431 LCRAGRYRSASKLLLSCLRSGMKILKSAQRAVLSGLRYSGFPGEARKVQSKIRIARIL 488 >EOX92885.1 Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 505 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/58 (50%), Positives = 39/58 (67%) Frame = -3 Query: 576 LCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 LCR GR+R ASKLLL C+ GM IL + +RA+LS SGF E + +SK+R+ I+ Sbjct: 446 LCRAGRYRSASKLLLSCLRSGMKILKSAQRAVLSGLRYSGFPGEARKVQSKIRIARIL 503 >XP_007215356.1 hypothetical protein PRUPE_ppa005519mg [Prunus persica] Length = 456 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/58 (48%), Positives = 39/58 (67%) Frame = -3 Query: 576 LCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 LCR GRFR ASKL++KC+ G IL A KRA+++ SSG+ E K + K++V I+ Sbjct: 398 LCRAGRFRCASKLMMKCLKDGKKILRATKRAVVAGLRSSGYTDEAKKLQWKIQVARIL 455 >ONI16672.1 hypothetical protein PRUPE_3G114500 [Prunus persica] ONI16673.1 hypothetical protein PRUPE_3G114500 [Prunus persica] Length = 457 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/58 (48%), Positives = 39/58 (67%) Frame = -3 Query: 576 LCRVGRFRLASKLLLKCVSHGMPILAADKRAILSAYHSSGFKSEIKAFRSKLRVP*IM 403 LCR GRFR ASKL++KC+ G IL A KRA+++ SSG+ E K + K++V I+ Sbjct: 399 LCRAGRFRCASKLMMKCLKDGKKILRATKRAVVAGLRSSGYTDEAKKLQWKIQVARIL 456