BLASTX nr result
ID: Lithospermum23_contig00036776
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00036776 (318 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012831412.1 PREDICTED: tRNA (guanine-N(7)-)-methyltransferase... 57 3e-07 XP_011093413.1 PREDICTED: tRNA (guanine-N(7)-)-methyltransferase... 57 3e-07 EYU42262.1 hypothetical protein MIMGU_mgv1a008653mg [Erythranthe... 57 4e-07 >XP_012831412.1 PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Erythranthe guttata] Length = 294 Score = 56.6 bits (135), Expect = 3e-07 Identities = 28/53 (52%), Positives = 38/53 (71%), Gaps = 7/53 (13%) Frame = +1 Query: 181 HSFFRTNASAYEYN-------DEKNSPQLVSLEYADLNLTDKFCEEVGHVRVR 318 ++F R A+A Y+ +E SP+LV+ +YADLNL+DKFCEEVGHVR+R Sbjct: 27 YTFRRRTAAAAAYSALPSSEREEIRSPELVARQYADLNLSDKFCEEVGHVRIR 79 >XP_011093413.1 PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Sesamum indicum] Length = 295 Score = 56.6 bits (135), Expect = 3e-07 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 7/49 (14%) Frame = +1 Query: 193 RTNASAYEY-------NDEKNSPQLVSLEYADLNLTDKFCEEVGHVRVR 318 RT A+A Y DE SP+LV+ EYADLNL+DKFC+EVGHVR+R Sbjct: 32 RTAAAAAVYPALSLPERDEIRSPELVAREYADLNLSDKFCQEVGHVRIR 80 >EYU42262.1 hypothetical protein MIMGU_mgv1a008653mg [Erythranthe guttata] Length = 366 Score = 56.6 bits (135), Expect = 4e-07 Identities = 28/53 (52%), Positives = 38/53 (71%), Gaps = 7/53 (13%) Frame = +1 Query: 181 HSFFRTNASAYEYN-------DEKNSPQLVSLEYADLNLTDKFCEEVGHVRVR 318 ++F R A+A Y+ +E SP+LV+ +YADLNL+DKFCEEVGHVR+R Sbjct: 99 YTFRRRTAAAAAYSALPSSEREEIRSPELVARQYADLNLSDKFCEEVGHVRIR 151