BLASTX nr result
ID: Lithospermum23_contig00036536
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00036536 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH98052.1 Carbohydrate kinase, FGGY, conserved site-containing ... 69 3e-13 XP_019167349.1 PREDICTED: glycerol kinase [Ipomoea nil] 65 7e-12 AIT39761.1 glycerol kinase, partial [Chrysanthemum boreale] 63 2e-11 CDO98178.1 unnamed protein product [Coffea canephora] 64 2e-11 KZV56035.1 glycerol kinase [Dorcoceras hygrometricum] 65 3e-11 KVH68345.1 Carbohydrate kinase, FGGY, conserved site-containing ... 62 2e-10 CBI36374.3 unnamed protein product, partial [Vitis vinifera] 62 4e-10 XP_017215164.1 PREDICTED: glycerol kinase [Daucus carota subsp. ... 61 4e-10 CAN76048.1 hypothetical protein VITISV_037711 [Vitis vinifera] 62 8e-10 XP_002273367.1 PREDICTED: glycerol kinase [Vitis vinifera] CBI36... 62 8e-10 XP_012856615.1 PREDICTED: LOW QUALITY PROTEIN: glycerol kinase [... 60 1e-09 EYU21675.1 hypothetical protein MIMGU_mgv1a019703mg [Erythranthe... 60 1e-09 AMP83208.1 glycerol kinase [Carica papaya] 60 2e-09 GAV78236.1 FGGY_N domain-containing protein/FGGY_C domain-contai... 57 2e-09 XP_018806799.1 PREDICTED: glycerol kinase [Juglans regia] 57 2e-09 XP_011081977.1 PREDICTED: glycerol kinase [Sesamum indicum] 59 2e-09 XP_018839929.1 PREDICTED: glycerol kinase-like, partial [Juglans... 57 2e-09 KVH99109.1 Carbohydrate kinase, FGGY, conserved site-containing ... 60 3e-09 XP_019241805.1 PREDICTED: glycerol kinase [Nicotiana attenuata] ... 60 6e-09 XP_009758692.1 PREDICTED: glycerol kinase [Nicotiana sylvestris] 60 6e-09 >KVH98052.1 Carbohydrate kinase, FGGY, conserved site-containing protein [Cynara cardunculus var. scolymus] Length = 522 Score = 68.6 bits (166), Expect(2) = 3e-13 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 +MKKDT F P+L+EE R KKVASWCKA+ERTFDLADLS+ Sbjct: 484 RMKKDTTFNPVLNEELRKKKVASWCKAVERTFDLADLSI 522 Score = 33.5 bits (75), Expect(2) = 3e-13 Identities = 19/33 (57%), Positives = 20/33 (60%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*KK 234 IETT AV VWTEEEIFS+ ER KK Sbjct: 455 IETTALGAAYAAGLAVGVWTEEEIFSNGERMKK 487 >XP_019167349.1 PREDICTED: glycerol kinase [Ipomoea nil] Length = 523 Score = 65.5 bits (158), Expect(2) = 7e-12 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 KMKKDT F+P+++EE R KKV SWCKA+ RTFDLADLSL Sbjct: 485 KMKKDTIFKPVIEEEVRKKKVDSWCKAVSRTFDLADLSL 523 Score = 32.0 bits (71), Expect(2) = 7e-12 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*KK 234 IETT AV +WTE+EIFSS E+ KK Sbjct: 456 IETTALGAAYAAGLAVGIWTEDEIFSSGEKMKK 488 >AIT39761.1 glycerol kinase, partial [Chrysanthemum boreale] Length = 514 Score = 62.8 bits (151), Expect(2) = 2e-11 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 +MKKDT F P+L++E R KKVASWCKA+ ++FDLADLSL Sbjct: 476 RMKKDTTFNPVLNDELREKKVASWCKAVGKSFDLADLSL 514 Score = 33.5 bits (75), Expect(2) = 2e-11 Identities = 19/33 (57%), Positives = 20/33 (60%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*KK 234 IETT AV VWTEEEIFS+ ER KK Sbjct: 447 IETTALGAAYAAGLAVGVWTEEEIFSNGERMKK 479 >CDO98178.1 unnamed protein product [Coffea canephora] Length = 522 Score = 63.5 bits (153), Expect(2) = 2e-11 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 KMKK T FQP+L+E R KKV SWCKA+ RTFDLADLSL Sbjct: 484 KMKKATNFQPVLEEGLRKKKVESWCKAVSRTFDLADLSL 522 Score = 32.3 bits (72), Expect(2) = 2e-11 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*KKIQN 225 IETT AV +WTE+EIFS+ E+ KK N Sbjct: 455 IETTALGAAYAAGLAVGIWTEDEIFSAGEKMKKATN 490 >KZV56035.1 glycerol kinase [Dorcoceras hygrometricum] Length = 523 Score = 65.5 bits (158), Expect(2) = 3e-11 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 K KKDTKF PI+D+E R KKV SWCKA+ RTFDLADLSL Sbjct: 485 KAKKDTKFFPIMDDELRKKKVDSWCKAVSRTFDLADLSL 523 Score = 29.6 bits (65), Expect(2) = 3e-11 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*KK 234 IETT AV VWTE EIFS E+ KK Sbjct: 456 IETTALGAAYAAGLAVGVWTENEIFSCGEKAKK 488 >KVH68345.1 Carbohydrate kinase, FGGY, conserved site-containing protein, partial [Cynara cardunculus var. scolymus] Length = 559 Score = 62.0 bits (149), Expect(2) = 2e-10 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLAD 139 +MKKDT F P+L+E+ R KKVASWCKA+E+TFDLAD Sbjct: 410 RMKKDTTFNPVLNEKLRKKKVASWCKAVEKTFDLAD 445 Score = 30.8 bits (68), Expect(2) = 2e-10 Identities = 18/33 (54%), Positives = 19/33 (57%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*KK 234 I TT AV VWTEEEIFS+ ER KK Sbjct: 381 IVTTALGAAYAAGLAVGVWTEEEIFSNGERMKK 413 >CBI36374.3 unnamed protein product, partial [Vitis vinifera] Length = 117 Score = 62.0 bits (149), Expect = 4e-10 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 K+K T F P LDEE RNKKV SWCKA+ RTFDLADLSL Sbjct: 79 KVKLATTFYPALDEERRNKKVESWCKAVSRTFDLADLSL 117 >XP_017215164.1 PREDICTED: glycerol kinase [Daucus carota subsp. sativus] KZM88449.1 hypothetical protein DCAR_025524 [Daucus carota subsp. sativus] Length = 518 Score = 60.8 bits (146), Expect(2) = 4e-10 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 +MK T F PIL+EE R KKV SWCKA+ RTFDLADLSL Sbjct: 480 RMKIATTFNPILEEEKRKKKVESWCKAVSRTFDLADLSL 518 Score = 30.4 bits (67), Expect(2) = 4e-10 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*K 237 IETT AV VW EEEIFSS ER K Sbjct: 451 IETTALGAAYAAGLAVGVWKEEEIFSSGERMK 482 >CAN76048.1 hypothetical protein VITISV_037711 [Vitis vinifera] Length = 522 Score = 62.0 bits (149), Expect(2) = 8e-10 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 K+K T F P LDEE RNKKV SWCKA+ RTFDLADLSL Sbjct: 484 KVKLATTFYPALDEERRNKKVESWCKAVSRTFDLADLSL 522 Score = 28.5 bits (62), Expect(2) = 8e-10 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*K 237 IETT AV +WTE+EIF S E+ K Sbjct: 455 IETTALGAAYAAGLAVGIWTEDEIFDSGEKVK 486 >XP_002273367.1 PREDICTED: glycerol kinase [Vitis vinifera] CBI36391.3 unnamed protein product, partial [Vitis vinifera] Length = 522 Score = 62.0 bits (149), Expect(2) = 8e-10 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 K+K T F P LDEE RNKKV SWCKA+ RTFDLADLSL Sbjct: 484 KVKLATTFYPALDEERRNKKVESWCKAVSRTFDLADLSL 522 Score = 28.5 bits (62), Expect(2) = 8e-10 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*K 237 IETT AV +WTE+EIF S E+ K Sbjct: 455 IETTALGAAYAAGLAVGIWTEDEIFDSGEKVK 486 >XP_012856615.1 PREDICTED: LOW QUALITY PROTEIN: glycerol kinase [Erythranthe guttata] Length = 522 Score = 59.7 bits (143), Expect(2) = 1e-09 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 K +K T F+P+L EE R KKV SWCKA+ RTFDLADLSL Sbjct: 484 KQEKPTVFRPVLGEEVRKKKVESWCKAVSRTFDLADLSL 522 Score = 30.0 bits (66), Expect(2) = 1e-09 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*KK 234 IETT AV VWTE EIFSS E+ +K Sbjct: 455 IETTALGAAYAAGLAVGVWTENEIFSSVEKQEK 487 >EYU21675.1 hypothetical protein MIMGU_mgv1a019703mg [Erythranthe guttata] Length = 510 Score = 59.7 bits (143), Expect(2) = 1e-09 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 K +K T F+P+L EE R KKV SWCKA+ RTFDLADLSL Sbjct: 472 KQEKPTVFRPVLGEEVRKKKVESWCKAVSRTFDLADLSL 510 Score = 30.0 bits (66), Expect(2) = 1e-09 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*KK 234 IETT AV VWTE EIFSS E+ +K Sbjct: 443 IETTALGAAYAAGLAVGVWTENEIFSSVEKQEK 475 >AMP83208.1 glycerol kinase [Carica papaya] Length = 523 Score = 59.7 bits (143), Expect(2) = 2e-09 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 K K T F P+L+EE R KKV SWCKA+ERTF LADLSL Sbjct: 485 KSKTSTSFHPVLEEELRKKKVESWCKAVERTFGLADLSL 523 Score = 29.6 bits (65), Expect(2) = 2e-09 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -1 Query: 329 ETTXXXXXXXXXXAVDVWTEEEIFSSEER*K 237 ETT AV +WTE+EIF+SEE+ K Sbjct: 457 ETTALGAAYAAGLAVGIWTEKEIFNSEEKSK 487 >GAV78236.1 FGGY_N domain-containing protein/FGGY_C domain-containing protein [Cephalotus follicularis] Length = 523 Score = 57.4 bits (137), Expect(2) = 2e-09 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 ++K T F+P L+E+ R KKV SWCKA+ERTFDLADLS+ Sbjct: 485 RVKTSTTFRPKLEEQLREKKVNSWCKAVERTFDLADLSI 523 Score = 31.6 bits (70), Expect(2) = 2e-09 Identities = 18/32 (56%), Positives = 19/32 (59%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*K 237 IETT AV VWTEEEIF+S ER K Sbjct: 456 IETTALGAAYAAGLAVGVWTEEEIFASGERVK 487 >XP_018806799.1 PREDICTED: glycerol kinase [Juglans regia] Length = 523 Score = 57.0 bits (136), Expect(2) = 2e-09 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 K+K T F+P L EE R KKV SWCKA+ RTFDLADLSL Sbjct: 485 KLKSATIFRPNLGEELRKKKVESWCKAVSRTFDLADLSL 523 Score = 32.0 bits (71), Expect(2) = 2e-09 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*K 237 IETT AV VWTE+EIF+SEE+ K Sbjct: 456 IETTALGAAYAAGLAVGVWTEDEIFASEEKLK 487 >XP_011081977.1 PREDICTED: glycerol kinase [Sesamum indicum] Length = 522 Score = 59.3 bits (142), Expect(2) = 2e-09 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 K +KDT F+P +DE+ R +KV SWCKA+ RTFDLADLSL Sbjct: 484 KTEKDTVFRPAIDEQLRKQKVESWCKAVTRTFDLADLSL 522 Score = 29.6 bits (65), Expect(2) = 2e-09 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*KK 234 IETT AV VWTE++IFSS E+ +K Sbjct: 455 IETTALGAAYAAGLAVGVWTEDQIFSSGEKTEK 487 >XP_018839929.1 PREDICTED: glycerol kinase-like, partial [Juglans regia] Length = 204 Score = 57.0 bits (136), Expect(2) = 2e-09 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 K+K T F+P L EE R KKV SWCKA+ RTFDLADLSL Sbjct: 166 KLKSATIFRPNLGEELRKKKVESWCKAVSRTFDLADLSL 204 Score = 32.0 bits (71), Expect(2) = 2e-09 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*K 237 IETT AV VWTE+EIF+SEE+ K Sbjct: 137 IETTALGAAYAAGLAVGVWTEDEIFASEEKLK 168 >KVH99109.1 Carbohydrate kinase, FGGY, conserved site-containing protein, partial [Cynara cardunculus var. scolymus] Length = 369 Score = 60.5 bits (145), Expect(2) = 3e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLS 133 +MK+DTKF P L EE R KKVASW KA+ER+FDLADLS Sbjct: 331 RMKQDTKFTPALSEEVRKKKVASWFKAVERSFDLADLS 368 Score = 28.1 bits (61), Expect(2) = 3e-09 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*KK 234 IETT V +W E ++FS+EER K+ Sbjct: 302 IETTALGAAYAAGLGVGIWKENDLFSNEERMKQ 334 >XP_019241805.1 PREDICTED: glycerol kinase [Nicotiana attenuata] OIT19143.1 glycerol kinase [Nicotiana attenuata] Length = 522 Score = 59.7 bits (143), Expect(2) = 6e-09 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 KMKK T F+P+L+EE R KKV SWC A+ R+FDLADLSL Sbjct: 484 KMKKATTFKPVLEEELRKKKVDSWCLAVSRSFDLADLSL 522 Score = 27.7 bits (60), Expect(2) = 6e-09 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*KK 234 IETT AV V+T++EIFSS E+ KK Sbjct: 455 IETTALGAAYAAGLAVGVYTQDEIFSSGEKMKK 487 >XP_009758692.1 PREDICTED: glycerol kinase [Nicotiana sylvestris] Length = 522 Score = 59.7 bits (143), Expect(2) = 6e-09 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 246 KMKKDTKFQPILDEESRNKKVASWCKAIERTFDLADLSL 130 KMKK T F+P+L+EE R KKV SWC A+ R+FDLADLSL Sbjct: 484 KMKKATTFKPVLEEELRKKKVDSWCLAVSRSFDLADLSL 522 Score = 27.7 bits (60), Expect(2) = 6e-09 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -1 Query: 332 IETTXXXXXXXXXXAVDVWTEEEIFSSEER*KK 234 IETT AV V+T++EIFSS E+ KK Sbjct: 455 IETTALGAAYAAGLAVGVYTQDEIFSSGEKMKK 487