BLASTX nr result
ID: Lithospermum23_contig00036307
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00036307 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015623483.1 PREDICTED: protein REVEILLE 1 isoform X1 [Oryza s... 54 2e-06 >XP_015623483.1 PREDICTED: protein REVEILLE 1 isoform X1 [Oryza sativa Japonica Group] Length = 525 Score = 54.3 bits (129), Expect = 2e-06 Identities = 29/40 (72%), Positives = 31/40 (77%), Gaps = 3/40 (7%) Frame = +1 Query: 175 NYPYS-LCFPFCVSAC--AEHIGTKTAVQIRSHAQKFFTK 285 N PYS +C CV C AEHIGTKTAVQIRSHAQKFF+K Sbjct: 103 NCPYSPVCRNVCVRLCVDAEHIGTKTAVQIRSHAQKFFSK 142