BLASTX nr result
ID: Lithospermum23_contig00036192
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00036192 (398 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV21710.1 single-stranded DNA-binding protein, mitochondrial [D... 58 2e-07 CDO98483.1 unnamed protein product [Coffea canephora] 57 2e-07 CAN67299.1 hypothetical protein VITISV_002040 [Vitis vinifera] 55 5e-07 XP_012838484.1 PREDICTED: single-stranded DNA-binding protein, m... 56 6e-07 XP_011090228.1 PREDICTED: single-stranded DNA-binding protein, m... 56 8e-07 XP_004299246.1 PREDICTED: single-stranded DNA-binding protein, m... 55 2e-06 KVI06469.1 Nucleic acid-binding, OB-fold [Cynara cardunculus var... 55 2e-06 XP_016545703.1 PREDICTED: single-stranded DNA-binding protein, m... 55 2e-06 XP_006345336.1 PREDICTED: single-stranded DNA-binding protein, m... 55 2e-06 XP_015059762.1 PREDICTED: single-stranded DNA-binding protein, m... 55 3e-06 XP_004252243.1 PREDICTED: single-stranded DNA-binding protein, m... 55 3e-06 XP_010507010.1 PREDICTED: single-stranded DNA-binding protein, m... 54 3e-06 XP_010925025.1 PREDICTED: single-stranded DNA-binding protein, m... 54 3e-06 XP_019189653.1 PREDICTED: single-stranded DNA-binding protein, m... 54 3e-06 XP_009337501.1 PREDICTED: single-stranded DNA-binding protein, m... 54 3e-06 XP_019189652.1 PREDICTED: single-stranded DNA-binding protein, m... 54 3e-06 OAY59302.1 hypothetical protein MANES_01G021700 [Manihot esculenta] 54 4e-06 OEL33242.1 hypothetical protein BAE44_0005741 [Dichanthelium oli... 54 4e-06 XP_020098147.1 single-stranded DNA-binding protein, mitochondria... 54 4e-06 OAY79701.1 Single-stranded DNA-binding protein, mitochondrial [A... 54 4e-06 >KZV21710.1 single-stranded DNA-binding protein, mitochondrial [Dorcoceras hygrometricum] Length = 212 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 291 SFCCSSIVYIEGNLETKIFNDSITGLVRRVREISIR 398 +F SI+Y+EGNLETKIFND ITGLVRR+REI++R Sbjct: 149 NFVPGSILYVEGNLETKIFNDPITGLVRRIREIAVR 184 >CDO98483.1 unnamed protein product [Coffea canephora] Length = 170 Score = 56.6 bits (135), Expect = 2e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 S++Y+EGNLETKIFND ITGLVRR+REI+IR Sbjct: 112 SVLYVEGNLETKIFNDPITGLVRRIREIAIR 142 >CAN67299.1 hypothetical protein VITISV_002040 [Vitis vinifera] Length = 122 Score = 54.7 bits (130), Expect = 5e-07 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 303 SSIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SS++Y+EGNLETKIF D +TGLVRR+RE++IR Sbjct: 79 SSVLYLEGNLETKIFTDPVTGLVRRIREVAIR 110 >XP_012838484.1 PREDICTED: single-stranded DNA-binding protein, mitochondrial [Erythranthe guttata] EYU36001.1 hypothetical protein MIMGU_mgv1a013728mg [Erythranthe guttata] Length = 212 Score = 56.2 bits (134), Expect = 6e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SI+Y+EGNLETKIFND ITGLVRR+RE++IR Sbjct: 153 SILYLEGNLETKIFNDPITGLVRRIREVAIR 183 >XP_011090228.1 PREDICTED: single-stranded DNA-binding protein, mitochondrial [Sesamum indicum] XP_011090230.1 PREDICTED: single-stranded DNA-binding protein, mitochondrial [Sesamum indicum] Length = 217 Score = 55.8 bits (133), Expect = 8e-07 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SI+Y+EGNLETKIFND ITGL+RR+RE+++R Sbjct: 159 SILYVEGNLETKIFNDPITGLIRRIREVAVR 189 >XP_004299246.1 PREDICTED: single-stranded DNA-binding protein, mitochondrial [Fragaria vesca subsp. vesca] Length = 210 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SI+Y+EGNLETKIF D +TGLVRRVREI++R Sbjct: 153 SIIYVEGNLETKIFTDPVTGLVRRVREIAVR 183 >KVI06469.1 Nucleic acid-binding, OB-fold [Cynara cardunculus var. scolymus] Length = 267 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SI+Y+EGNLETKIFND ITGL RRVREI+IR Sbjct: 211 SILYLEGNLETKIFNDPITGLTRRVREIAIR 241 >XP_016545703.1 PREDICTED: single-stranded DNA-binding protein, mitochondrial [Capsicum annuum] Length = 221 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SI+Y+EGNLETKIF D ITGLVRRVREI++R Sbjct: 163 SILYVEGNLETKIFTDPITGLVRRVREIAVR 193 >XP_006345336.1 PREDICTED: single-stranded DNA-binding protein, mitochondrial [Solanum tuberosum] Length = 229 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SI+Y+EGNLETKIF D ITGLVRR+REI+IR Sbjct: 170 SILYVEGNLETKIFTDPITGLVRRIREIAIR 200 >XP_015059762.1 PREDICTED: single-stranded DNA-binding protein, mitochondrial [Solanum pennellii] Length = 231 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SI+Y+EGNLETKIF D ITGLVRR+REI+IR Sbjct: 172 SILYVEGNLETKIFTDPITGLVRRIREIAIR 202 >XP_004252243.1 PREDICTED: single-stranded DNA-binding protein, mitochondrial [Solanum lycopersicum] Length = 231 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SI+Y+EGNLETKIF D ITGLVRR+REI+IR Sbjct: 172 SILYVEGNLETKIFTDPITGLVRRIREIAIR 202 >XP_010507010.1 PREDICTED: single-stranded DNA-binding protein, mitochondrial-like [Camelina sativa] Length = 217 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 S+VY+EGNLETKIF D +TGLVRR+RE++IR Sbjct: 159 SVVYLEGNLETKIFTDPVTGLVRRIREVAIR 189 >XP_010925025.1 PREDICTED: single-stranded DNA-binding protein, mitochondrial [Elaeis guineensis] Length = 220 Score = 54.3 bits (129), Expect = 3e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SI+Y+EGNLETK+F+D ITGLVRR+REI+IR Sbjct: 162 SILYLEGNLETKVFSDPITGLVRRIREIAIR 192 >XP_019189653.1 PREDICTED: single-stranded DNA-binding protein, mitochondrial isoform X2 [Ipomoea nil] Length = 224 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SI+YIEGNLETK+F+D ITGLVRR+RE+++R Sbjct: 166 SILYIEGNLETKVFSDPITGLVRRIREVAVR 196 >XP_009337501.1 PREDICTED: single-stranded DNA-binding protein, mitochondrial-like [Pyrus x bretschneideri] Length = 229 Score = 54.3 bits (129), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SI+Y+EGNLETKIF D ++GLVRRVREISIR Sbjct: 171 SIIYVEGNLETKIFADPVSGLVRRVREISIR 201 >XP_019189652.1 PREDICTED: single-stranded DNA-binding protein, mitochondrial isoform X1 [Ipomoea nil] Length = 230 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SI+YIEGNLETK+F+D ITGLVRR+RE+++R Sbjct: 172 SILYIEGNLETKVFSDPITGLVRRIREVAVR 202 >OAY59302.1 hypothetical protein MANES_01G021700 [Manihot esculenta] Length = 233 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 SI+Y+EGNLETK+F D ITGLVRR+RE++IR Sbjct: 174 SIIYLEGNLETKVFTDPITGLVRRIREVAIR 204 >OEL33242.1 hypothetical protein BAE44_0005741 [Dichanthelium oligosanthes] Length = 239 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/32 (71%), Positives = 31/32 (96%) Frame = +3 Query: 303 SSIVYIEGNLETKIFNDSITGLVRRVREISIR 398 S+I+Y+EGNLETK+F+D ITGLVRR+REI++R Sbjct: 175 STILYLEGNLETKVFSDPITGLVRRIREIAVR 206 >XP_020098147.1 single-stranded DNA-binding protein, mitochondrial [Ananas comosus] Length = 221 Score = 53.9 bits (128), Expect = 4e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 S++Y+EGNLETK+F+D ITGLVRR+REI+IR Sbjct: 163 SVLYLEGNLETKVFSDPITGLVRRIREIAIR 193 >OAY79701.1 Single-stranded DNA-binding protein, mitochondrial [Ananas comosus] Length = 221 Score = 53.9 bits (128), Expect = 4e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +3 Query: 306 SIVYIEGNLETKIFNDSITGLVRRVREISIR 398 S++Y+EGNLETK+F+D ITGLVRR+REI+IR Sbjct: 163 SVLYLEGNLETKVFSDPITGLVRRIREIAIR 193