BLASTX nr result
ID: Lithospermum23_contig00036157
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00036157 (245 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP09417.1 unnamed protein product [Coffea canephora] 55 3e-07 >CDP09417.1 unnamed protein product [Coffea canephora] Length = 206 Score = 55.1 bits (131), Expect = 3e-07 Identities = 28/43 (65%), Positives = 31/43 (72%) Frame = -1 Query: 245 LQKEMLQQQPSINKTESSLYMERSSKLLLYHNDDEPSHHHQQQ 117 LQ+EML Q P+IN ESSL M +SSKL L NDDE SH QQQ Sbjct: 159 LQREMLMQPPTINSAESSLCMGKSSKLHLCFNDDESSHQQQQQ 201