BLASTX nr result
ID: Lithospermum23_contig00036021
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00036021 (309 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019260467.1 PREDICTED: metal tolerance protein 10-like isofor... 94 8e-21 XP_019260466.1 PREDICTED: metal tolerance protein 9-like isoform... 94 2e-20 XP_016493461.1 PREDICTED: metal tolerance protein 9-like [Nicoti... 94 2e-20 XP_009763110.1 PREDICTED: metal tolerance protein 9-like [Nicoti... 94 2e-20 XP_009593111.1 PREDICTED: metal tolerance protein 9 [Nicotiana t... 94 2e-20 CDP13561.1 unnamed protein product [Coffea canephora] 92 1e-19 XP_018857081.1 PREDICTED: metal tolerance protein 10-like isofor... 91 1e-19 XP_018856112.1 PREDICTED: metal tolerance protein 10-like isofor... 91 1e-19 XP_017239161.1 PREDICTED: metal tolerance protein 9 [Daucus caro... 91 2e-19 XP_018807809.1 PREDICTED: metal tolerance protein 10-like [Jugla... 91 3e-19 KVI02329.1 Cation efflux protein, partial [Cynara cardunculus va... 90 5e-19 XP_015089449.1 PREDICTED: metal tolerance protein 9 [Solanum pen... 89 8e-19 XP_004248331.1 PREDICTED: metal tolerance protein 9 [Solanum lyc... 89 8e-19 XP_018857914.1 PREDICTED: metal tolerance protein 10-like [Jugla... 89 1e-18 XP_006352589.1 PREDICTED: metal tolerance protein 9-like [Solanu... 89 1e-18 XP_019236964.1 PREDICTED: metal tolerance protein 10-like [Nicot... 89 1e-18 OMO99048.1 Cation efflux protein [Corchorus capsularis] 89 1e-18 XP_009770453.1 PREDICTED: metal tolerance protein 10-like [Nicot... 88 2e-18 KNA17301.1 hypothetical protein SOVF_081290 [Spinacia oleracea] 88 2e-18 XP_010692560.1 PREDICTED: metal tolerance protein 10 isoform X2 ... 87 4e-18 >XP_019260467.1 PREDICTED: metal tolerance protein 10-like isoform X2 [Nicotiana attenuata] Length = 340 Score = 94.0 bits (232), Expect = 8e-21 Identities = 43/58 (74%), Positives = 53/58 (91%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GKIA+YYKKQERLLEGF+EM+ IN+SGCLPG+LT+DEM++LA+ ERMAI SN+AN Sbjct: 4 KQGKIAEYYKKQERLLEGFNEMDTINESGCLPGSLTEDEMKQLARSERMAIHLSNMAN 61 >XP_019260466.1 PREDICTED: metal tolerance protein 9-like isoform X1 [Nicotiana attenuata] OIT39174.1 metal tolerance protein 10 [Nicotiana attenuata] Length = 416 Score = 94.0 bits (232), Expect = 2e-20 Identities = 43/58 (74%), Positives = 53/58 (91%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GKIA+YYKKQERLLEGF+EM+ IN+SGCLPG+LT+DEM++LA+ ERMAI SN+AN Sbjct: 80 KQGKIAEYYKKQERLLEGFNEMDTINESGCLPGSLTEDEMKQLARSERMAIHLSNMAN 137 >XP_016493461.1 PREDICTED: metal tolerance protein 9-like [Nicotiana tabacum] Length = 416 Score = 94.0 bits (232), Expect = 2e-20 Identities = 43/58 (74%), Positives = 53/58 (91%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GKIA+YYKKQERLLEGF+EM+ IN+SGCLPG+LT+DEM++LA+ ERMAI SN+AN Sbjct: 80 KQGKIAEYYKKQERLLEGFNEMDTINESGCLPGSLTEDEMKQLARSERMAIHLSNMAN 137 >XP_009763110.1 PREDICTED: metal tolerance protein 9-like [Nicotiana sylvestris] Length = 416 Score = 94.0 bits (232), Expect = 2e-20 Identities = 43/58 (74%), Positives = 53/58 (91%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GKIA+YYKKQERLLEGF+EM+ IN+SGCLPG+LT+DEM++LA+ ERMAI SN+AN Sbjct: 80 KQGKIAEYYKKQERLLEGFNEMDTINESGCLPGSLTEDEMKQLARSERMAIHLSNMAN 137 >XP_009593111.1 PREDICTED: metal tolerance protein 9 [Nicotiana tomentosiformis] XP_016510274.1 PREDICTED: metal tolerance protein 9-like [Nicotiana tabacum] Length = 416 Score = 94.0 bits (232), Expect = 2e-20 Identities = 43/58 (74%), Positives = 53/58 (91%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GKIA+YYKKQERLLEGF+EM+ IN+SGCLPG+LT+DEM++LA+ ERMAI SN+AN Sbjct: 80 KQGKIAEYYKKQERLLEGFNEMDTINESGCLPGSLTEDEMKQLARSERMAIHLSNMAN 137 >CDP13561.1 unnamed protein product [Coffea canephora] Length = 413 Score = 91.7 bits (226), Expect = 1e-19 Identities = 43/58 (74%), Positives = 52/58 (89%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GKIA+YYKKQERLLEGF+EME IN+SGCL G+LT+DE+++LA+ ERMAI SNIAN Sbjct: 77 KKGKIAEYYKKQERLLEGFNEMETINESGCLHGSLTEDELKQLARSERMAIHVSNIAN 134 >XP_018857081.1 PREDICTED: metal tolerance protein 10-like isoform X1 [Juglans regia] Length = 340 Score = 90.9 bits (224), Expect = 1e-19 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K K+ADYYKKQERLLEGF+EME + ++GCLP +LT+DEM++LAK ERMAI ASNIAN Sbjct: 4 KRNKVADYYKKQERLLEGFNEMETMTENGCLPDSLTEDEMKQLAKSERMAIHASNIAN 61 >XP_018856112.1 PREDICTED: metal tolerance protein 10-like isoform X1 [Juglans regia] Length = 340 Score = 90.9 bits (224), Expect = 1e-19 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K K+ADYYKKQERLLEGF+EME + ++GCLP +LT+DEM++LAK ERMAI ASNIAN Sbjct: 4 KRNKVADYYKKQERLLEGFNEMETMTENGCLPDSLTEDEMKQLAKSERMAIHASNIAN 61 >XP_017239161.1 PREDICTED: metal tolerance protein 9 [Daucus carota subsp. sativus] KZN00902.1 hypothetical protein DCAR_009656 [Daucus carota subsp. sativus] Length = 398 Score = 90.9 bits (224), Expect = 2e-19 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GK+A+YY+KQE+LLEGF+EME IN++GCLPG LT+DEM +LA+ ERMAI SNIAN Sbjct: 62 KQGKVAEYYEKQEKLLEGFTEMETINETGCLPGNLTEDEMNQLARSERMAIHVSNIAN 119 >XP_018807809.1 PREDICTED: metal tolerance protein 10-like [Juglans regia] Length = 405 Score = 90.5 bits (223), Expect = 3e-19 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K K+ADYYKKQERLLEGF+EME + ++GCLP +LT+DEM++LAK ERMAI ASNIAN Sbjct: 69 KRNKVADYYKKQERLLEGFNEMETMTENGCLPESLTEDEMKQLAKSERMAIHASNIAN 126 >KVI02329.1 Cation efflux protein, partial [Cynara cardunculus var. scolymus] Length = 444 Score = 90.1 bits (222), Expect = 5e-19 Identities = 40/58 (68%), Positives = 51/58 (87%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 KHGK+ +YYKKQ+RLLEGF+EME +N+SGCLPG+LT+DEM+ LAK E+ AI SN+AN Sbjct: 108 KHGKVQEYYKKQKRLLEGFNEMETMNESGCLPGSLTEDEMDNLAKNEKRAIYVSNMAN 165 >XP_015089449.1 PREDICTED: metal tolerance protein 9 [Solanum pennellii] Length = 412 Score = 89.4 bits (220), Expect = 8e-19 Identities = 40/58 (68%), Positives = 52/58 (89%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GKIA+YYK+QERL+EGF+EM+ IN+SGCLP +LT+DEM++LA+ ERMAI SN+AN Sbjct: 76 KQGKIAEYYKRQERLVEGFNEMDTINESGCLPASLTEDEMKQLARSERMAIHLSNMAN 133 >XP_004248331.1 PREDICTED: metal tolerance protein 9 [Solanum lycopersicum] Length = 412 Score = 89.4 bits (220), Expect = 8e-19 Identities = 40/58 (68%), Positives = 52/58 (89%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GKIA+YYK+QERL+EGF+EM+ IN+SGCLP +LT+DEM++LA+ ERMAI SN+AN Sbjct: 76 KQGKIAEYYKRQERLVEGFNEMDTINESGCLPASLTEDEMKQLARSERMAIHLSNMAN 133 >XP_018857914.1 PREDICTED: metal tolerance protein 10-like [Juglans regia] Length = 405 Score = 89.0 bits (219), Expect = 1e-18 Identities = 41/58 (70%), Positives = 49/58 (84%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K K+ADYYKKQERLLEGF+EME + ++GCLP LT+DEM++L K ERMAI ASNIAN Sbjct: 69 KRNKVADYYKKQERLLEGFNEMETMTENGCLPDGLTEDEMKQLVKSERMAIHASNIAN 126 >XP_006352589.1 PREDICTED: metal tolerance protein 9-like [Solanum tuberosum] Length = 413 Score = 89.0 bits (219), Expect = 1e-18 Identities = 40/58 (68%), Positives = 52/58 (89%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GKIA+YYK+QERL+EGF+EM+ IN+SGCLP +LT++EM++LAK ERMAI SN+AN Sbjct: 77 KQGKIAEYYKRQERLVEGFNEMDTINESGCLPASLTEEEMKQLAKSERMAIHLSNMAN 134 >XP_019236964.1 PREDICTED: metal tolerance protein 10-like [Nicotiana attenuata] OIT22750.1 metal tolerance protein 10 [Nicotiana attenuata] Length = 401 Score = 88.6 bits (218), Expect = 1e-18 Identities = 40/58 (68%), Positives = 52/58 (89%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GK+A+YY+KQERLLEGF+EM+ +++SG LPG+LT+DEM++LAK ERMAI SNIAN Sbjct: 65 KQGKVAEYYEKQERLLEGFNEMDTVHESGSLPGSLTEDEMKQLAKSERMAIHVSNIAN 122 >OMO99048.1 Cation efflux protein [Corchorus capsularis] Length = 402 Score = 88.6 bits (218), Expect = 1e-18 Identities = 39/58 (67%), Positives = 52/58 (89%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K K+++YYKKQERLL GF+EME +N++GCLPG+LT+DEM++LA+ ERMA+ ASNIAN Sbjct: 66 KQRKVSEYYKKQERLLAGFNEMETMNETGCLPGSLTEDEMKQLARSERMAVHASNIAN 123 >XP_009770453.1 PREDICTED: metal tolerance protein 10-like [Nicotiana sylvestris] XP_016468281.1 PREDICTED: metal tolerance protein 10-like [Nicotiana tabacum] Length = 399 Score = 88.2 bits (217), Expect = 2e-18 Identities = 40/58 (68%), Positives = 52/58 (89%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GK+A+YY+KQERLLEGF+EM+ +++SG LPG+LT+DEM++LAK ERMAI SNIAN Sbjct: 63 KQGKVAEYYEKQERLLEGFNEMDTVHESGFLPGSLTEDEMKQLAKSERMAIHVSNIAN 120 >KNA17301.1 hypothetical protein SOVF_081290 [Spinacia oleracea] Length = 377 Score = 87.8 bits (216), Expect = 2e-18 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GK+ADYYKKQERLLEGF+EME IN++G PG+LT+DEM++LAK ERMAI SN AN Sbjct: 41 KQGKVADYYKKQERLLEGFNEMESINETGFFPGSLTEDEMKKLAKHERMAITISNAAN 98 >XP_010692560.1 PREDICTED: metal tolerance protein 10 isoform X2 [Beta vulgaris subsp. vulgaris] KMS99756.1 hypothetical protein BVRB_1g021200 [Beta vulgaris subsp. vulgaris] Length = 378 Score = 87.0 bits (214), Expect = 4e-18 Identities = 38/58 (65%), Positives = 50/58 (86%) Frame = +3 Query: 135 KHGKIADYYKKQERLLEGFSEMEIINKSGCLPGALTKDEMEELAKGERMAIRASNIAN 308 K GK+A+YYKKQERLLEG++EME I ++GC PG++T+DEM++LAK ERMA+ SN AN Sbjct: 42 KQGKVAEYYKKQERLLEGYNEMENITETGCFPGSMTEDEMKQLAKSERMAVNISNAAN 99