BLASTX nr result
ID: Lithospermum23_contig00035795
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00035795 (379 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP77511.1 NADH-ubiquinone oxidoreductase 49 kDa subunit [Cajanu... 53 4e-07 >KYP77511.1 NADH-ubiquinone oxidoreductase 49 kDa subunit [Cajanus cajan] Length = 446 Score = 52.8 bits (125), Expect(2) = 4e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 208 KGSEGKSATSYKAPIRYREGYHSQMQSNYP 119 + S+GK+ATS+KA IRYREGYHSQ++SNYP Sbjct: 303 RSSDGKAATSHKAQIRYREGYHSQVRSNYP 332 Score = 28.5 bits (62), Expect(2) = 4e-07 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 378 QSLETTGWESKRTLRPFL 325 Q LE T WE+ RTLR FL Sbjct: 260 QPLEATSWETNRTLRVFL 277