BLASTX nr result
ID: Lithospermum23_contig00035793
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00035793 (399 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010316794.1 PREDICTED: CLAVATA3/ESR (CLE)-related protein 2 [... 53 1e-06 >XP_010316794.1 PREDICTED: CLAVATA3/ESR (CLE)-related protein 2 [Solanum lycopersicum] Length = 73 Score = 52.8 bits (125), Expect = 1e-06 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 2/43 (4%) Frame = +2 Query: 125 VRPIKIAREAFEAQFQKELRGKKYGHA--DRVSPGGPDPHHHF 247 +R I+IAREA E QF++E + K H RVSPGGPDPHHHF Sbjct: 29 IRSIRIAREALEEQFERE-KAKVGAHEWPQRVSPGGPDPHHHF 70