BLASTX nr result
ID: Lithospermum23_contig00035762
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00035762 (439 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABR25328.1 glutaredoxin related protein, partial [Oryza sativa I... 62 4e-10 KJB69508.1 hypothetical protein B456_011G027200 [Gossypium raimo... 66 6e-10 XP_012455587.1 PREDICTED: monothiol glutaredoxin-S17 [Gossypium ... 66 6e-10 XP_007025641.1 PREDICTED: monothiol glutaredoxin-S17 [Theobroma ... 66 6e-10 XP_010241953.1 PREDICTED: monothiol glutaredoxin-S17 [Nelumbo nu... 66 6e-10 OMO76418.1 Glutaredoxin [Corchorus capsularis] 66 7e-10 XP_016734030.1 PREDICTED: monothiol glutaredoxin-S17-like [Gossy... 66 8e-10 OMO65170.1 Glutaredoxin [Corchorus olitorius] 65 1e-09 XP_019445665.1 PREDICTED: monothiol glutaredoxin-S17 [Lupinus an... 65 1e-09 XP_004134708.1 PREDICTED: monothiol glutaredoxin-S17 [Cucumis sa... 65 1e-09 XP_015889174.1 PREDICTED: monothiol glutaredoxin-S17-like [Zizip... 65 1e-09 ABK94877.1 unknown [Populus trichocarpa] 64 2e-09 XP_017649551.1 PREDICTED: monothiol glutaredoxin-S17 [Gossypium ... 65 2e-09 CDO99552.1 unnamed protein product [Coffea canephora] 65 2e-09 XP_010686506.1 PREDICTED: monothiol glutaredoxin-S17 [Beta vulga... 65 2e-09 XP_006377345.1 thioredoxin family protein [Populus trichocarpa] ... 64 3e-09 XP_019266070.1 PREDICTED: monothiol glutaredoxin-S17 [Nicotiana ... 64 3e-09 XP_016499580.1 PREDICTED: monothiol glutaredoxin-S17-like [Nicot... 64 3e-09 XP_009612933.1 PREDICTED: monothiol glutaredoxin-S17 [Nicotiana ... 64 3e-09 XP_009770416.1 PREDICTED: monothiol glutaredoxin-S17 [Nicotiana ... 64 3e-09 >ABR25328.1 glutaredoxin related protein, partial [Oryza sativa Indica Group] Length = 59 Score = 61.6 bits (148), Expect = 4e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYK ELIGGCDIVLE+ SGELK+TLSE Sbjct: 27 TFPQLYYKSELIGGCDIVLELEKSGELKSTLSE 59 >KJB69508.1 hypothetical protein B456_011G027200 [Gossypium raimondii] Length = 439 Score = 66.2 bits (160), Expect = 6e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKGELIGGCDIVLE+R++GELKATLSE Sbjct: 407 TFPQLYYKGELIGGCDIVLELRNNGELKATLSE 439 >XP_012455587.1 PREDICTED: monothiol glutaredoxin-S17 [Gossypium raimondii] KJB69507.1 hypothetical protein B456_011G027200 [Gossypium raimondii] KJB69509.1 hypothetical protein B456_011G027200 [Gossypium raimondii] Length = 489 Score = 66.2 bits (160), Expect = 6e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKGELIGGCDIVLE+R++GELKATLSE Sbjct: 457 TFPQLYYKGELIGGCDIVLELRNNGELKATLSE 489 >XP_007025641.1 PREDICTED: monothiol glutaredoxin-S17 [Theobroma cacao] EOY28263.1 Glutaredoxin S17 [Theobroma cacao] Length = 489 Score = 66.2 bits (160), Expect = 6e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKGELIGGCDIVLE+R++GELKATLSE Sbjct: 457 TFPQLYYKGELIGGCDIVLELRNNGELKATLSE 489 >XP_010241953.1 PREDICTED: monothiol glutaredoxin-S17 [Nelumbo nucifera] Length = 495 Score = 66.2 bits (160), Expect = 6e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKGELIGGCDIVLE+R+SGELK+TLSE Sbjct: 463 TFPQLYYKGELIGGCDIVLELRNSGELKSTLSE 495 >OMO76418.1 Glutaredoxin [Corchorus capsularis] Length = 937 Score = 66.2 bits (160), Expect = 7e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKGELIGGCDIVLE++S+GELKATLSE Sbjct: 905 TFPQLYYKGELIGGCDIVLELKSNGELKATLSE 937 >XP_016734030.1 PREDICTED: monothiol glutaredoxin-S17-like [Gossypium hirsutum] Length = 489 Score = 65.9 bits (159), Expect = 8e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKGELIGGCDI+LE+R++GELKATLSE Sbjct: 457 TFPQLYYKGELIGGCDIILELRNNGELKATLSE 489 >OMO65170.1 Glutaredoxin [Corchorus olitorius] Length = 486 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKGELIGGCDIVLE++++GELKATLSE Sbjct: 454 TFPQLYYKGELIGGCDIVLELKNNGELKATLSE 486 >XP_019445665.1 PREDICTED: monothiol glutaredoxin-S17 [Lupinus angustifolius] OIW10412.1 hypothetical protein TanjilG_05560 [Lupinus angustifolius] Length = 490 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKGELIGGCDIVLE+R++GELK+TLSE Sbjct: 458 TFPQLYYKGELIGGCDIVLELRNNGELKSTLSE 490 >XP_004134708.1 PREDICTED: monothiol glutaredoxin-S17 [Cucumis sativus] KGN49222.1 hypothetical protein Csa_6G517300 [Cucumis sativus] Length = 490 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKG+LIGGCDIVLE++S+GELKATLSE Sbjct: 458 TFPQLYYKGDLIGGCDIVLELKSNGELKATLSE 490 >XP_015889174.1 PREDICTED: monothiol glutaredoxin-S17-like [Ziziphus jujuba] XP_015889181.1 PREDICTED: monothiol glutaredoxin-S17-like [Ziziphus jujuba] Length = 492 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKGELIGGCDIVLE++S+GELK+TLSE Sbjct: 460 TFPQLYYKGELIGGCDIVLELKSNGELKSTLSE 492 >ABK94877.1 unknown [Populus trichocarpa] Length = 208 Score = 63.5 bits (153), Expect = 2e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKGELIGGCDI++E+R +GELK+TLSE Sbjct: 176 TFPQLYYKGELIGGCDIIMELRDNGELKSTLSE 208 >XP_017649551.1 PREDICTED: monothiol glutaredoxin-S17 [Gossypium arboreum] KHF99491.1 Monothiol glutaredoxin-S17 -like protein [Gossypium arboreum] Length = 489 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKGELIGGCDIVLE+R++GELK TLSE Sbjct: 457 TFPQLYYKGELIGGCDIVLELRNNGELKVTLSE 489 >CDO99552.1 unnamed protein product [Coffea canephora] Length = 490 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKGELIGGCDI+LE++S+GELK+TLSE Sbjct: 458 TFPQLYYKGELIGGCDIILELKSNGELKSTLSE 490 >XP_010686506.1 PREDICTED: monothiol glutaredoxin-S17 [Beta vulgaris subsp. vulgaris] XP_010686507.1 PREDICTED: monothiol glutaredoxin-S17 [Beta vulgaris subsp. vulgaris] KMT04257.1 hypothetical protein BVRB_8g183330 [Beta vulgaris subsp. vulgaris] Length = 492 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 T+PQLYYKGELIGGCDI+LEM++SGELK+TLSE Sbjct: 460 TYPQLYYKGELIGGCDIILEMKNSGELKSTLSE 492 >XP_006377345.1 thioredoxin family protein [Populus trichocarpa] ERP55142.1 thioredoxin family protein [Populus trichocarpa] Length = 454 Score = 64.3 bits (155), Expect = 3e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 TFPQLYYKGELIGGCDI+LE+R +GELK+TLSE Sbjct: 422 TFPQLYYKGELIGGCDIILELRDNGELKSTLSE 454 >XP_019266070.1 PREDICTED: monothiol glutaredoxin-S17 [Nicotiana attenuata] OIT05494.1 monothiol glutaredoxin-s17 [Nicotiana attenuata] Length = 481 Score = 64.3 bits (155), Expect = 3e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 T+PQLYYKGEL+GGCDIVLE++SSGELK+TLSE Sbjct: 449 TYPQLYYKGELVGGCDIVLELQSSGELKSTLSE 481 >XP_016499580.1 PREDICTED: monothiol glutaredoxin-S17-like [Nicotiana tabacum] Length = 481 Score = 64.3 bits (155), Expect = 3e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 T+PQLYYKGEL+GGCDIVLE++SSGELK+TLSE Sbjct: 449 TYPQLYYKGELVGGCDIVLELQSSGELKSTLSE 481 >XP_009612933.1 PREDICTED: monothiol glutaredoxin-S17 [Nicotiana tomentosiformis] XP_016506969.1 PREDICTED: monothiol glutaredoxin-S17-like [Nicotiana tabacum] Length = 481 Score = 64.3 bits (155), Expect = 3e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 T+PQLYYKGEL+GGCDIVLE++SSGELK+TLSE Sbjct: 449 TYPQLYYKGELVGGCDIVLELQSSGELKSTLSE 481 >XP_009770416.1 PREDICTED: monothiol glutaredoxin-S17 [Nicotiana sylvestris] Length = 484 Score = 64.3 bits (155), Expect = 3e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = +3 Query: 3 TFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 101 T+PQLYYKGEL+GGCDIVLE++SSGELK+TLSE Sbjct: 452 TYPQLYYKGELVGGCDIVLELQSSGELKSTLSE 484