BLASTX nr result
ID: Lithospermum23_contig00035443
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00035443 (218 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016478379.1 PREDICTED: WEB family protein At3g02930, chloropl... 86 8e-18 XP_009791830.1 PREDICTED: WEB family protein At3g02930, chloropl... 86 8e-18 XP_016478378.1 PREDICTED: WEB family protein At3g02930, chloropl... 86 8e-18 XP_009791829.1 PREDICTED: WEB family protein At3g02930, chloropl... 86 8e-18 XP_016478377.1 PREDICTED: WEB family protein At3g02930, chloropl... 86 8e-18 XP_009791828.1 PREDICTED: WEB family protein At3g02930, chloropl... 86 8e-18 XP_019263247.1 PREDICTED: WEB family protein At3g02930, chloropl... 84 3e-17 XP_019263246.1 PREDICTED: WEB family protein At3g02930, chloropl... 84 3e-17 XP_019263245.1 PREDICTED: WEB family protein At3g02930, chloropl... 84 3e-17 XP_011084631.1 PREDICTED: WEB family protein At3g02930, chloropl... 81 2e-16 XP_016515952.1 PREDICTED: WEB family protein At5g16730, chloropl... 81 3e-16 XP_009609480.1 PREDICTED: WEB family protein At5g16730, chloropl... 81 3e-16 XP_018628704.1 PREDICTED: WEB family protein At3g02930, chloropl... 81 3e-16 XP_018628703.1 PREDICTED: WEB family protein At3g02930, chloropl... 81 3e-16 XP_016515951.1 PREDICTED: WEB family protein At3g02930, chloropl... 81 3e-16 XP_009609479.1 PREDICTED: WEB family protein At3g02930, chloropl... 81 3e-16 XP_016515950.1 PREDICTED: WEB family protein At3g02930, chloropl... 81 3e-16 XP_009609478.1 PREDICTED: WEB family protein At3g02930, chloropl... 81 3e-16 OMO96589.1 hypothetical protein COLO4_15190 [Corchorus olitorius] 80 5e-16 OMO50496.1 hypothetical protein CCACVL1_30405 [Corchorus capsula... 80 5e-16 >XP_016478379.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X3 [Nicotiana tabacum] Length = 856 Score = 85.5 bits (210), Expect = 8e-18 Identities = 42/72 (58%), Positives = 52/72 (72%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI+RLVN L +AEE+ S +E H KNS+KE ESE Sbjct: 563 WEEKELHLMSCMKKTEEENSSMEKEISRLVNLLKDAEEEASAKKDEEAHLKNSLKEAESE 622 Query: 36 VIYLKDALGGAK 1 V YLK+ LG AK Sbjct: 623 VTYLKEVLGEAK 634 >XP_009791830.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X3 [Nicotiana sylvestris] Length = 856 Score = 85.5 bits (210), Expect = 8e-18 Identities = 42/72 (58%), Positives = 52/72 (72%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI+RLVN L +AEE+ S +E H KNS+KE ESE Sbjct: 563 WEEKELHLMSCMKKTEEENSSMEKEISRLVNLLKDAEEEASAKKDEEAHLKNSLKEAESE 622 Query: 36 VIYLKDALGGAK 1 V YLK+ LG AK Sbjct: 623 VTYLKEVLGEAK 634 >XP_016478378.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X2 [Nicotiana tabacum] Length = 876 Score = 85.5 bits (210), Expect = 8e-18 Identities = 42/72 (58%), Positives = 52/72 (72%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI+RLVN L +AEE+ S +E H KNS+KE ESE Sbjct: 583 WEEKELHLMSCMKKTEEENSSMEKEISRLVNLLKDAEEEASAKKDEEAHLKNSLKEAESE 642 Query: 36 VIYLKDALGGAK 1 V YLK+ LG AK Sbjct: 643 VTYLKEVLGEAK 654 >XP_009791829.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X2 [Nicotiana sylvestris] Length = 876 Score = 85.5 bits (210), Expect = 8e-18 Identities = 42/72 (58%), Positives = 52/72 (72%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI+RLVN L +AEE+ S +E H KNS+KE ESE Sbjct: 583 WEEKELHLMSCMKKTEEENSSMEKEISRLVNLLKDAEEEASAKKDEEAHLKNSLKEAESE 642 Query: 36 VIYLKDALGGAK 1 V YLK+ LG AK Sbjct: 643 VTYLKEVLGEAK 654 >XP_016478377.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X1 [Nicotiana tabacum] Length = 878 Score = 85.5 bits (210), Expect = 8e-18 Identities = 42/72 (58%), Positives = 52/72 (72%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI+RLVN L +AEE+ S +E H KNS+KE ESE Sbjct: 585 WEEKELHLMSCMKKTEEENSSMEKEISRLVNLLKDAEEEASAKKDEEAHLKNSLKEAESE 644 Query: 36 VIYLKDALGGAK 1 V YLK+ LG AK Sbjct: 645 VTYLKEVLGEAK 656 >XP_009791828.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X1 [Nicotiana sylvestris] Length = 878 Score = 85.5 bits (210), Expect = 8e-18 Identities = 42/72 (58%), Positives = 52/72 (72%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI+RLVN L +AEE+ S +E H KNS+KE ESE Sbjct: 585 WEEKELHLMSCMKKTEEENSSMEKEISRLVNLLKDAEEEASAKKDEEAHLKNSLKEAESE 644 Query: 36 VIYLKDALGGAK 1 V YLK+ LG AK Sbjct: 645 VTYLKEVLGEAK 656 >XP_019263247.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X3 [Nicotiana attenuata] OIT37278.1 web family protein, chloroplastic [Nicotiana attenuata] Length = 878 Score = 84.0 bits (206), Expect = 3e-17 Identities = 41/72 (56%), Positives = 52/72 (72%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI+RLVN L +AEE+ S +E H KNS+KE ESE Sbjct: 585 WEEKELHLMSCMKKTEEENSSMEKEISRLVNLLKDAEEEASAKKDEEAHLKNSLKEAESE 644 Query: 36 VIYLKDALGGAK 1 V YLK+ LG A+ Sbjct: 645 VTYLKEVLGEAQ 656 >XP_019263246.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X2 [Nicotiana attenuata] Length = 886 Score = 84.0 bits (206), Expect = 3e-17 Identities = 41/72 (56%), Positives = 52/72 (72%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI+RLVN L +AEE+ S +E H KNS+KE ESE Sbjct: 593 WEEKELHLMSCMKKTEEENSSMEKEISRLVNLLKDAEEEASAKKDEEAHLKNSLKEAESE 652 Query: 36 VIYLKDALGGAK 1 V YLK+ LG A+ Sbjct: 653 VTYLKEVLGEAQ 664 >XP_019263245.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X1 [Nicotiana attenuata] Length = 888 Score = 84.0 bits (206), Expect = 3e-17 Identities = 41/72 (56%), Positives = 52/72 (72%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI+RLVN L +AEE+ S +E H KNS+KE ESE Sbjct: 595 WEEKELHLMSCMKKTEEENSSMEKEISRLVNLLKDAEEEASAKKDEEAHLKNSLKEAESE 654 Query: 36 VIYLKDALGGAK 1 V YLK+ LG A+ Sbjct: 655 VTYLKEVLGEAQ 666 >XP_011084631.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like [Sesamum indicum] Length = 841 Score = 81.3 bits (199), Expect = 2e-16 Identities = 43/72 (59%), Positives = 50/72 (69%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WEQKE L SVK E++NSSME EI+RLVN L AEE+ + EE +K S KE ESE Sbjct: 540 WEQKELDLMTSVKKSEEENSSMENEISRLVNLLKMAEEEACATREEEDRWKTSFKEAESE 599 Query: 36 VIYLKDALGGAK 1 VIYLK+ LG AK Sbjct: 600 VIYLKEVLGEAK 611 >XP_016515952.1 PREDICTED: WEB family protein At5g16730, chloroplastic-like isoform X3 [Nicotiana tabacum] Length = 722 Score = 80.9 bits (198), Expect = 3e-16 Identities = 40/72 (55%), Positives = 50/72 (69%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI++LVN L +AEE S +E H KNS+KE ESE Sbjct: 421 WEEKELHLMSCMKKTEEENSSMEKEISQLVNLLKDAEEVASAKKDEEAHLKNSLKEAESE 480 Query: 36 VIYLKDALGGAK 1 V YLK+ LG K Sbjct: 481 VTYLKEVLGEEK 492 >XP_009609480.1 PREDICTED: WEB family protein At5g16730, chloroplastic-like isoform X5 [Nicotiana tomentosiformis] Length = 722 Score = 80.9 bits (198), Expect = 3e-16 Identities = 40/72 (55%), Positives = 50/72 (69%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI++LVN L +AEE S +E H KNS+KE ESE Sbjct: 421 WEEKELHLMSCMKKTEEENSSMEKEISQLVNLLKDAEEVASAKKDEEAHLKNSLKEAESE 480 Query: 36 VIYLKDALGGAK 1 V YLK+ LG K Sbjct: 481 VTYLKEVLGKEK 492 >XP_018628704.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X4 [Nicotiana tomentosiformis] Length = 838 Score = 80.9 bits (198), Expect = 3e-16 Identities = 40/72 (55%), Positives = 50/72 (69%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI++LVN L +AEE S +E H KNS+KE ESE Sbjct: 537 WEEKELHLMSCMKKTEEENSSMEKEISQLVNLLKDAEEVASAKKDEEAHLKNSLKEAESE 596 Query: 36 VIYLKDALGGAK 1 V YLK+ LG K Sbjct: 597 VTYLKEVLGKEK 608 >XP_018628703.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X3 [Nicotiana tomentosiformis] Length = 838 Score = 80.9 bits (198), Expect = 3e-16 Identities = 40/72 (55%), Positives = 50/72 (69%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI++LVN L +AEE S +E H KNS+KE ESE Sbjct: 537 WEEKELHLMSCMKKTEEENSSMEKEISQLVNLLKDAEEVASAKKDEEAHLKNSLKEAESE 596 Query: 36 VIYLKDALGGAK 1 V YLK+ LG K Sbjct: 597 VTYLKEVLGKEK 608 >XP_016515951.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X2 [Nicotiana tabacum] Length = 875 Score = 80.9 bits (198), Expect = 3e-16 Identities = 40/72 (55%), Positives = 50/72 (69%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI++LVN L +AEE S +E H KNS+KE ESE Sbjct: 574 WEEKELHLMSCMKKTEEENSSMEKEISQLVNLLKDAEEVASAKKDEEAHLKNSLKEAESE 633 Query: 36 VIYLKDALGGAK 1 V YLK+ LG K Sbjct: 634 VTYLKEVLGEEK 645 >XP_009609479.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X2 [Nicotiana tomentosiformis] Length = 875 Score = 80.9 bits (198), Expect = 3e-16 Identities = 40/72 (55%), Positives = 50/72 (69%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI++LVN L +AEE S +E H KNS+KE ESE Sbjct: 574 WEEKELHLMSCMKKTEEENSSMEKEISQLVNLLKDAEEVASAKKDEEAHLKNSLKEAESE 633 Query: 36 VIYLKDALGGAK 1 V YLK+ LG K Sbjct: 634 VTYLKEVLGKEK 645 >XP_016515950.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X1 [Nicotiana tabacum] Length = 877 Score = 80.9 bits (198), Expect = 3e-16 Identities = 40/72 (55%), Positives = 50/72 (69%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI++LVN L +AEE S +E H KNS+KE ESE Sbjct: 576 WEEKELHLMSCMKKTEEENSSMEKEISQLVNLLKDAEEVASAKKDEEAHLKNSLKEAESE 635 Query: 36 VIYLKDALGGAK 1 V YLK+ LG K Sbjct: 636 VTYLKEVLGEEK 647 >XP_009609478.1 PREDICTED: WEB family protein At3g02930, chloroplastic-like isoform X1 [Nicotiana tomentosiformis] Length = 877 Score = 80.9 bits (198), Expect = 3e-16 Identities = 40/72 (55%), Positives = 50/72 (69%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WE+KE L +K E++NSSMEKEI++LVN L +AEE S +E H KNS+KE ESE Sbjct: 576 WEEKELHLMSCMKKTEEENSSMEKEISQLVNLLKDAEEVASAKKDEEAHLKNSLKEAESE 635 Query: 36 VIYLKDALGGAK 1 V YLK+ LG K Sbjct: 636 VTYLKEVLGKEK 647 >OMO96589.1 hypothetical protein COLO4_15190 [Corchorus olitorius] Length = 846 Score = 80.5 bits (197), Expect = 5e-16 Identities = 40/72 (55%), Positives = 51/72 (70%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WEQKE VK E++NSS+EKEINRLVN L ++EE+ S S EE + K S+KE ESE Sbjct: 543 WEQKELHFVNCVKKSEEENSSLEKEINRLVNLLKQSEEEASASREEESQLKESLKEVESE 602 Query: 36 VIYLKDALGGAK 1 VIYL++A+ K Sbjct: 603 VIYLQEAIKEVK 614 >OMO50496.1 hypothetical protein CCACVL1_30405 [Corchorus capsularis] Length = 846 Score = 80.5 bits (197), Expect = 5e-16 Identities = 40/72 (55%), Positives = 51/72 (70%) Frame = -3 Query: 216 WEQKEAQLTQSVKVYEQKNSSMEKEINRLVNSLHEAEEKVSLSLEENTHFKNSIKETESE 37 WEQKE VK E++NSS+EKEINRLVN L ++EE+ S S EE + K S+KE ESE Sbjct: 543 WEQKELHFVNCVKKSEEENSSLEKEINRLVNLLKQSEEEASASREEESQLKESLKEVESE 602 Query: 36 VIYLKDALGGAK 1 VIYL++A+ K Sbjct: 603 VIYLQEAIKEVK 614